ESTScan Details for Unigene SGN-U296371

Score 
356
Direction 
Forward
Predicted Peptide Sequence 
RDGGEVVPIPSRVESLAKSGIQVIPKEYVRPQEELNGIGNIFEDEKKDEGPQXTDNYLKEIDSEDKEIREKCHQELKESSSGVGCNAPRL
TMXISDELIDRVKVAGSTFFDLPVEEKEKYAYDQX
Predicted Coding Sequence 
AGAGATGGTGGTGAAGTGGTTCCAATTCCTTCAAGAGTTGAAAGCTTGGCTAAAAGTGGAATCCAAGTCATTCCTAAAGAGTATGTGAGG
CCACAAGAAGAGTTAAATGGTATAGGAAACATCTTTGAGGATGAAAAGAAAGATGAAGGACCTCAAGXTACCGACAATTATCTGAAAGAA
ATCGACTCAGAGGACAAGGAAATTCGCGAAAAATGCCACCAGGAGTTGAAAGAAAGCAGCAGTGGAGTGGGGTGTAATGCACCTCGGTTA
ACCATGGXGATATCGGATGAGCTAATTGATCGAGTCAAGGTTGCTGGAAGTACCTTTTTTGATTTACCTGTTGAAGAGAAGGAGAAGTAT
GCTTATGATCAAGXX\
Edits in Original Sequence 
(5')AGAGATGGTGaGTGAAGTGGTTCCAATTCCTTCAAGAGTTGAAAGCTTGGCTAAAAGTGGAATCCAAGTCATTCCTAAAGAGTATG
TGAGGCCACAAGAAGAGTTAAATGGTATAGGAAACATCTTTGAGGATGAAAAGAAAGATGAAGGACCTCAAGXTACCGACAATTATCTGA
AAGAAATCGACTCAGAGGACAAGGAAATTCGCGAAAAATGCCACCAGGAGTTGAAAGAAAGCAGCAGTGGAGTGGGGTGTAATGCACCTC
GGTTAACCATGGXGATATCGGATGAGCTAATTGATCGAGTCAAGGTTGCTGGAAGTACCTTTTTTGATTTACCTGTTGAAGAGAAGGAGA
AGTATGCTTaATGATCAAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan