ESTScan Details for Unigene SGN-U296487

Score 
501
Direction 
Forward
Predicted Peptide Sequence 
MGAIEIFLVSLMIASCLVPSVSAATRHYKFEIKMQNVTRLCHTKSIVTVNGQFPGPRIVAREGDRLEIEVVNHVHNNISIHWHGIRQVRS
GWADGPAYVTQCPIQTGHKYLYNFTIIGQRGTFWWHAHISWLRSTLYGPIIILPKKNTPYPFAKPYKEVPIIFGEWFNADTEAIISQALQ
TGGGPNVSDAYTINGX
Predicted Coding Sequence 
ATGGGTGCTATTGAAATATTTCTTGTCTCTCTCATGATTGCATCGTGTCTCGTCCCTAGCGTTTCCGCTGCAACCAGACACTATAAATTT
GAAATAAAAATGCAAAATGTGACACGACTATGTCACACAAAGAGTATAGTTACAGTAAATGGACAATTTCCTGGACCTAGAATTGTGGCT
AGGGAAGGTGATCGTCTTGAAATTGAAGTTGTCAATCATGTTCACAACAACATTTCTATCCATTGGCATGGAATTCGACAAGTTCGTAGT
GGATGGGCAGATGGACCAGCCTATGTAACACAATGTCCAATTCAAACTGGCCACAAATATTTGTATAATTTCACTATAATTGGCCAAAGA
GGAACTTTTTGGTGGCATGCACATATTTCATGGTTGAGATCAACTCTCTATGGTCCTATTATTATTCTTCCTAAAAAAAATACTCCTTAT
CCATTTGCTAAACCATACAAAGAAGTTCCCATAATCTTTGGAGAATGGTTCAATGCTGATACTGAAGCTATAATTTCCCAAGCTTTACAA
ACAGGTGGAGGCCCTAATGTTTCTGATGCTTATACTATCAATGGACXX\
Edits in Original Sequence 
CAAAGGAAAAAAAAAATCAAAATTTGATTTTCTTTGCGCAAAA(5')ATGGGTGCTATTGAAATATTTCTTGTCTCTCTCATGATTGCAT
CGTGTCTCGTCCCTAGCGTTTCCGCTGCAACCAGACACTATAAATTTGAAATAAAAATGCAAAATGTGACACGACTATGTCACACAAAGA
GTATAGTTACAGTAAATGGACAATTTCCTGGACCTAGAATTGTGGCTAGGGAAGGTGATCGTCTTGAAATTGAAGTTGTCAATCATGTTC
ACAACAACATTTCTATCCATTGGCATGGAATTCGACAAGTTCGTAGTGGATGGGCAGATGGACCAGCCTATGTAACACAATGTCCAATTC
AAACTGGCCACAAATATTTGTATAATTTCACTATAATTGGCCAAAGAGGAACTTTTTGGTGGCATGCACATATTTCATGGTTGAGATCAA
CTCTCTATGGTCCTATTATTATTCTTCCTAAAAAAAATACTCCTTATCCATTTGCTAAACCATACAAAGAAGTTCCCATAATCTTTGGAG
AATGGTTCAATGCTGATACTGAAGCTATAATTTCCCAAGCTTTACAAACAGGTGGAGGCCCTAATGTTTCTGATGCTTATACTATCAATG
GACXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan