ESTScan Details for Unigene SGN-U296496

Score 
297
Direction 
Forward
Predicted Peptide Sequence 
MASQRFARQFXDNPFLKIQELPGNTVKRNSESLKKANCDPKGTSLVVTRDVDLDTTKNTWLRLYVPRRLTKNPTPKKLALIMYYHGGGFV
YXSMAQLLFIFDVFCQALAERVGAMVISLRVRLAPEXSLPTAYDDAMDGLEWLKTTKDEWVCNYADLSKVXLGGTSSGGNLAYNAGLRAA
AMAKTKPIXIRV
Predicted Coding Sequence 
ATGGCTAGCCAAAGATTTGCTCGTCAATTTXTTGACAATCCTTTCCTTAAGATTCAAGAATTACCAGGCAACACAGTTAAACGTAACTCT
GAATCCCTCAAAAAAGCCAATTGTGATCCAAAAGGCACATCATTAGTCGTAACTAGAGATGTTGATCTTGACACAACAAAAAACACTTGG
CTTCGACTATACGTCCCAAGACGTTTAACAAAAAATCCTACACCTAAGAAATTGGCACTCATTATGTACTATCACGGTGGAGGCTTTGTT
TATXTTTCCATGGCCCAATTACTTTTTATATTCGATGTGTTTTGCCAGGCACTTGCTGAAAGAGTTGGTGCTATGGTCATCTCACTTCGA
GTTCGTCTCGCCCCTGAAXCATCGCTTCCTACTGCTTATGATGATGCTATGGATGGGTTAGAATGGCTCAAGACTACTAAGGATGAATGG
GTTTGTAATTATGCTGATTTGAGTAAAGTTXTTCTTGGTGGAACTAGTTCTGGAGGCAATTTAGCTTATAATGCAGGGCTACGTGCGGCA
GCTATGGCAAAAACTAAGCCCATTAAXATCAGGGTTTAA\
Edits in Original Sequence 
GTCTGAATAAAACAATT(5')ATGGCTAGCCAAAGATTTGCTCGTCAATTTXTTGACAATCCTTTCCTTAAGATTCAAGAATTACCAGGC
AACACAGTTAAACGTAACTCTGAATCCCTCAAAAAAGCCAATTGTGATCCAAAAGGCACATCATTAGTCGTAACTAGAGATGTTGATCTT
GACACAACAAAAAACACTTGGCTTCGACTATACGTCCCAAGACGTTTAACAAAAAATCCTACACCTAAGAAATTGGCACTCATTATGTAC
TATCACGGTGGAGGCTTTGTTTATXTTTCCATGGCCCAATTACTTTTTATATTCGATGTGTTTTGCCAGGCACTTGCTGAAAGAGTTGGT
GCTATGGTCATCTCACTTCGAGTaTCGTCTCGCCCCTGAAXCATCGCTTCCTACTGCTTATGATGATGCTATGGATGGGTTAGAATGGCT
CAAGACTACTAAGGATGAATGGGTTTGTAATTATGCTGATTTGAGTAAAGTTXTTCTTGGTGGAACTAGTTCTGGAGGCAATTTAGCTTA
TAATGCAGGGCTACGTGCGGCAGCTATGGCAAAAACTAAGCCCATTAAXATCAGGGTTTAA\(3')TATTACATCATCCCATTTTTCAGT
TGGAAAAAAAACAGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan