ESTScan Details for Unigene SGN-U296509

Score 
426
Direction 
Reverse
Predicted Peptide Sequence 
INGNIGQVKIGDLGFATIVGKSHSAHSVLGTPEFMAPELYDEDYTELIDIYSFGMCVLEMVTLELPYSECDNVVKIYKKVISGVRPKAMD
KVKDPEFKKFIEKCLAQPRVRPSASELLQDPFFNDINDDDENDDEEYTSNNFWHA
Predicted Coding Sequence 
ATTAATGGCAATATTGGTCAGGTTAAGATTGGTGATTTGGGTTTTGCAACTATAGTAGGGAAGAGTCATTCAGCACATTCGGTTCTTGGA
ACCCCAGAGTTCATGGCACCGGAGTTGTATGATGAGGATTATACTGAGCTGATTGATATCTACTCGTTTGGGATGTGTGTTTTGGAGATG
GTGACGTTGGAACTACCCTATAGTGAGTGTGATAACGTGGTGAAGATATACAAGAAGGTAATATCCGGAGTGAGGCCTAAGGCCATGGAC
AAGGTTAAAGATCCTGAGTTCAAGAAGTTCATTGAGAAGTGTCTTGCTCAGCCTAGGGTTAGACCCTCTGCTTCTGAACTCCTTCAAGAC
CCTTTCTTTAATGATATTAATGATGATGACGAAAACGACGATGAAGAGTATACTAGTAACAACTTTTGGCATGCTTAG\
Edits in Original Sequence 
(5')ATTAATGGCAATATTGGTCAGGTTAAGATTGGTGATTTGGGTTTTGCAACTATAGTAGGGAAGAGTCATTCAGCACATTCGGTTCT
TGGAACCCCAGAGTTCATGGCACCGGAGTTGTATGATGAGGATTATACTGAGCTGATTGATATCTACTCGTTTGGGATGTGTGTTTTGGA
GATGGTGACGTTGGAACTACCCTATAGTGAGTGTGATAACGTGGTGAAGATATACAAGAAGGTAATATCCGGAGTGAGGCCTAAGGCCAT
GGACAAGGTTAAAGATCCTGAGTTCAAGAAGTTCATTGAGAAGTGTCTTGCTCAGCCTAGGGTTAGACCCTCTGCTTCTGAACTCCTTCA
AGACCCTTTCTTTAATGATATTAATGATGATGACGAAAACGACGATGAAGAGTATACTAGTAACAACTTTTGGCATGCTTAG\(3')ATC
AGCCATAGCTATTATTTGCTAGTATATTAGTTAGTTGTATTAGGTTTTGTTGTGGAGTTTTTGGTGTTGATTTGTTGCTTGTAGTGTTTT
TGCCTTTTCTTCCAAAAAGAAAATGGTTTTGCTTTTTATTATGAAACTATTGCAAAAGAAAAAACAATAGAAAAGAGTGGATTTTGGTTA
AGGAATTTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan