ESTScan Details for Unigene SGN-U296535

Score 
495
Direction 
Reverse
Predicted Peptide Sequence 
MDPALVAFCEKIATEGGPVSVXDELGGDALPQNPVLQSATLTRARARLRNVQPEVNLDQSFEALRRHKKHADSAQLVLDDELQPQDSLPS
KSSNDHEGDASEQRPESTLADGNKPADVPDATGDDAEMLQCQMQKCXRKIESVKKQFVKHTKDYGIPQLERLYTRIMKGVFETKTGVTNE
DLKTSILSFLLKFAKDASKF
Predicted Coding Sequence 
ATGGATCCTGCCTTAGTTGCTTTCTGTGAGAAGATTGCTACTGAAGGGGGTCCAGTGTCAGTTCNTGACGAATTAGGTGGAGATGCATTG
CCACAAAATCCCGTCTTACAGTCGGCTACTTTGACTAGAGCAAGAGCCCGCCTTCGTAATGTCCAGCCTGAAGTCAACTTAGATCAGAGC
TTTGAAGCACTGAGAAGGCACAAGAAACATGCTGATTCTGCACAATTGGTGCTAGATGATGAATTACAACCTCAGGATTCATTGCCTTCC
AAGTCATCTAATGACCATGAAGGAGATGCTTCAGAGCAAAGGCCAGAAAGCACTCTTGCTGACGGGAATAAACCCGCAGACGTGCCAGAT
GCAACTGGAGACGATGCCGAGATGTTACAATGTCAGATGCAGAAATGTCXCCGTAAAATCGAGTCCGTGAAGAAGCAATTCGTAAAGCAC
ACAAAGGACTACGGCATTCCTCAGCTAGAAAGATTATACACTCGCATCATGAAGGGTGTTTTCGAAACAAAAACTGGTGTGACAAACGAA
GATCTCAAGACTTCAATTTTGAGTTTCTTGTTAAAATTTGCAAAGGATGCGTCGAAGTTTTAG\
Edits in Original Sequence 
AGATTCAGTATATGGAATGCTTTCCCAA(5')ATGGATCCTGCCTTAGTTGCTTTCTGTGAGAAGATTGCTACTGAAGGGGGTCCAGTGT
CAGTTCNTGACGAATTAGGTGGAGATGCATTGCCACAAAATCCCGTCTTACAGTCGGCTACTTTGACTAGAGCAAGAGCCCGCCTTCGTA
ATGTCCAGCCTGAAGTCAACTTAGATCAGAGCTTTGAAGCACTGAGAAGGCACAAGAAACATGCTGATTCTGCACAATTGGTGCTAGATG
ATGAATTACAACCTCAGGATTCATTGCCTTCCAAGTCATCTAATGACCATGAAGGAGATGCTTCAGAGCAAAGGCCAGAAAGCACTCTTG
CTGACGGGAATAAACCCGCAGACGTGCCAGATGCAACTGGAGACGcATGCCGAGATGTTACAATGTCAGATGCAGAAATGTCXCCGTAAA
ATCGAGTCCGTGAAGAAGCAATTCGTAAAGCACACAAAGGACTACGGCATTCCTCAGCTAGAAAGATTATACACTCGCATCATGAAGGGT
GTTTTCGAAACAAAAACTGGTGTGACAAACGAAGATCTCAAGACTTCAATTTTGAGTTTCTTGTTAAAATTTGCAAAGGATGCGTCGAAG
TTTTAG\(3')TATAAACATGAATTTTTATTTTATTTTATTTTATTTTTTAGTTTCAACAATTTATTGATCCGCTCATACGATGTCAACG
AATTTGCTGCATCTATTGTGCTACACAGGCAAAAGAAAAGAAAATTATAGTCTTATTAAAAAAAGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan