ESTScan Details for Unigene SGN-U296830

Score 
153
Direction 
Reverse
Predicted Peptide Sequence 
TTRYVQTFRNPTPTTIFTPQIAYKYNFTPTCAVKLVEIYRKFTGDFLGFSKRVERDKFKGLEGDDYCXKIEDGDLQTPLSILSGVLANSL
AGRHLSFXAEKGTNVALILAKKGPESSLSLSTIAGAADSEVSMAWASARPFXLLVSIFHHSYANAGNIRISSTVLNAEGLKKTTIGLEKK
KRFWQRX
Predicted Coding Sequence 
XGCACAACCAGATATGTCCAAACTTTTCGCAATCCAACGCCGACTACTATTTTCACACCCCAAATTGCCTATAAATACAATTTCACACCA
ACCTGTGCAGTGAAACTCGTCGAAATCTACCGAAAATTCACTGGAGATTTTCTTGGGTTTTCGAAACGGGTTGAAAGAGACAAGTTTAAG
GGATTAGAAGGAGACGATTACTGTGAXAAGATTGAAGATGGGGACCTGCAAACTCCCCTCTCCATCCTCTCTGGCGTACTTGCAAACTCC
CTCGCCGGCCGCCACCTCTCATTCXTGGCGGAAAAAGGGACCAACGTCGCTCTCATTCTAGCGAAAAAGGGACCAGAGTCGTCTCTCTCC
CTCTCCACCATTGCGGGAGCTGCTGATTCTGAAGTATCCATGGCCTGGGCATCTGCTAGGCCATTTXCTCTTCTTGTTTCTATTTTTCAC
CATAGCTACGCGAATGCXGGAAACATAAGGATTTCTTCGACTGTTCTAAATGCTGAGGGGCTAAAGAAGACAACTATTGGTTTGGAGAAA
AAAAAGAGGTTTTGGCAGCGATGX\
Edits in Original Sequence 
(5')XGCACAACCAGATATGTCCAAACTTTTCGCAATCCAACGCCGACTACTATTTTCACACCCCAAATTGCCTATAAATACAATTTCAC
ACCAACCTGTGCAGTGAAACTCGTCGAAATCTACCGAAAATTCACTGGAGATTTTCTTGGGTTTTCGAAACGGGTTGAAAGAGACAAGTT
TAAGGGATTAGAAGGAGACGATTACTGTGAXAAGATTGAAGATGGGGACCTGCAAACTCCCCTCTCCATCCTCTCTGGCGTACTTGCAAA
CTCCCTCGCCGGCCGCCACCTCTCATTCXTGGCGGAAAAAGGGACCAACGTCGCTCTCATTCTAGCGAAAAAGGGACCAGAGTCGTCTCT
CTCCCTCTCaCACCATTGCGGGAGCTGCTGATTCTGAAGTATCCATGGCCTGGGCATCTGCTAGGCCATTTXCTCTTCTTGTTTCTATTT
TTCACCATAGCTACGCGAATGCXGGAAACATAAGGATTTCTTCGACTGTTCTAAATGCTGAGGGGCTAAAGAAGACAACTATTGGTTTGG
AGAAAAAAAAGAGGTTTTGGCAGCGATGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan