ESTScan Details for Unigene SGN-U296831

Score 
226
Direction 
Forward
Predicted Peptide Sequence 
MSSRRSRQSSTGSSRISDDQIIELVSKLQQLLPEIRNRRSSKASASKVLQETCNYIRNLNRQVDDLSDRLSQLLSTIDADSPEAASSGVY
Predicted Coding Sequence 
ATGTCGAGCAGAAGGTCGAGGCAATCATCAACAGGATCCTCGAGGATTTCAGATGATCAGATAATTGAACTTGTCTCAAAATTGCAACAG
CTTCTACCGGAGATTCGCAATCGTCGCTCTAGCAAGGCATCGGCATCGAAAGTACTGCAAGAAACATGCAACTACATAAGAAATTTGAAT
AGACAAGTGGATGATCTTAGTGATCGACTTTCTCAGTTACTCTCAACTATTGATGCTGATAGTCCAGAAGCAGCATCATCAGGAGTTTAT
TAA\
Edits in Original Sequence 
CCTTACCACAACTTCCTCTCCTTAACAAGTTTCATACACACACACAAAAAAAAATATCTTCTTTCTTTTCCTTATCCATATGTGTTGTGT
AAGCAATTAAATAAAAGAAAACTACGCTAGCACAGAGCCATATTTGTAACGAAAAGAGAGACATTTTTTTGTTGAATTTAAGG
(5')ATG
TCGAGCAGAAGGTCGAGGCAATCATCAACAGGATCCTCGAGGATTTCAGATGATCAGATAATTGAACTTGTCTCAAAATTGCAACAGCTT
CTACCGGAGATTCGCAATCGTCGCTCTAGCAAGGCATCGGCATCGAAAGTACTGCAAGAAACATGCAACTACATAAGAAATTTGAATAGA
CAAGTGGATGATCTTAGTGATCGACTTTCTCAGTTACTCTCAACTATTGATGCTGATAGTCCAGAAGCAGCaATCATCAGGAGTTTATTA
A\(3')TGTAGTAGCCATATACTCCTATGAATTAATTAATGTATTTTCATTTCTAAATATTGGAGCTATATTTATATATAAATCTTACTA
CCAAGTTCTTGATTTTCTGGTTGTTGTTAAGCTCTAGTAGACTCAGCTGGTCACTATAGCTAGGCCAATCATGAGTTAGAATTTAATTAG
AACTTCAACTATATAGTAGTGCCGATTGAACCAATGTGATCCCCCTAGCTAAGGGCACACGTACGTACGTTTGTATCTATATTTCCTTTA
CTCCTTAGTTAAATATAATTAATTAATAAGATGTACAAAGACAAGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan