ESTScan Details for Unigene SGN-U296858

Score 
226
Direction 
Forward
Predicted Peptide Sequence 
MVKSYLRYEPAACFGVIVSVESKIAYDSSGKHLLVPALEKIGIWHVRQGLCTKTLTPLPSSNSKAPSNAVTSISSSSSRIASGYAQGTIR
IWDSEKGMCETTLNGHKGAVTALRYNKLGSLLAS
Predicted Coding Sequence 
ATGGTGAAATCGTATCTCCGGTATGAACCAGCGGCGTGTTTTGGGGTTATAGTATCGGTTGAATCAAAGATTGCGTATGATTCGTCCGGC
AAACACTTGTTGGTGCCGGCGTTAGAGAAAATTGGCATATGGCATGTGAGGCAGGGTCTTTGCACCAAAACCCTAACTCCTTTACCTTCA
TCAAACTCAAAAGCCCCCTCTAATGCTGTCACATCAATTTCATCATCATCATCCCGCATAGCTAGTGGTTATGCTCAAGGAACTATTAGA
ATTTGGGATTCCGAGAAAGGGATGTGTGAAACCACATTGAATGGGCATAAAGGGGCTGTAACGGCACTTCGATACAATAAGCTTGGATCA
TTACTAGCATCX\
Edits in Original Sequence 
GAGCATTGGAGTTTGGAATGTATCAATATAAATTAAAAAAAAGTATAATCCAAAACCCCTGATAAAGTTAAACCCTAACAATCAGAGC(5')
ATGGTGAAATCGTATCTCCGGTATGAACCAGCGGCGTGTTTTGGGGTTATAGTATCGGTTGAATCAAAGATTGCGTATGATTCGTCCG
GCAAACACTTGTTGGTGCCGGCGTTAGAGAAAATTGGCATATGGCATGTGAGGCAGGGTCTTTGCACCAAAACCCTAACTCCTTTACCTT
CATCAAACTCAAAAGCCCCCTCTAATGCTGTCACATCAATTTCATCATCATCATCCCGCATAGCTAGTGGTTATGCTCAAGGAACTATTA
GAATTTGGGATTCCGAGAAAGGGATGTGTGAAACCACATTGAATGGGCATAAAGGGGCTGTAACGGCACTTCGATACAATAAGCTTGGAT
CATTACTAGCATCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan