ESTScan Details for Unigene SGN-U296873

Score 
937
Direction 
Forward
Predicted Peptide Sequence 
EEIHLGRIAAYKYSTAAALEEPIKPTVNVDHTKLFINGQFVDSASGKTFPTLDPRTGEVIAHIAEGDAEDINRAVAAARKAFDEGPWPRM
TAYERSKILLRLADLIEKHNDQIATLETWDTGKPYAQAAKIEVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWN
FPLLMFSWKIGPALACGNTIVLKMAEQTPLSALYVANLLQEAGLPEGVLNIISGFGATAGCFLSVVILDVDKAAFTGSTETGKTYLNWLK
TILX
Predicted Coding Sequence 
XXGGAAGAGATCCATCTTGGCAGAATCGCTGCTTATAAATACAGCACAGCGGCTGCTCTCGAGGAGCCCATCAAGCCTACTGTCAATGTG
GATCATACTAAACTTTTTATCAACGGGCAATTTGTTGATTCTGCATCAGGAAAAACTTTCCCAACTCTCGACCCCAGGACAGGGGAGGTA
ATTGCACATATTGCTGAAGGTGATGCAGAAGATATTAATCGGGCAGTAGCTGCTGCTCGTAAGGCTTTTGATGAAGGACCGTGGCCTAGG
ATGACTGCTTATGAAAGGTCAAAGATATTGCTGCGCCTTGCTGATCTGATTGAAAAACATAATGATCAAATTGCAACACTCGAGACTTGG
GACACTGGGAAGCCTTATGCACAAGCTGCTAAGATTGAAGTACCAATGGTTGTACGTCTACTCCGTTATTATGCTGGCTGGGCAGATAAA
ATTCATGGTATGACCATTCCTGCCGATGGACCATATCATGTTCAAACGTTGCATGAACCGATTGGGGTTGCTGGTCAGATTATCCCATGG
AATTTTCCTCTCCTCATGTTTTCTTGGAAGATTGGCCCTGCTTTAGCTTGTGGTAACACAATCGTGCTAAAGATGGCTGAGCAGACCCCA
TTATCTGCATTGTATGTAGCAAATCTATTGCAGGAGGCTGGCCTGCCTGAAGGTGTTCTGAATATCATTTCTGGTTTTGGTGCCACAGCT
GGGTGCTTCCTCTCTGTAGTCATATTGGATGTGGATAAAGCTGCTTTTACTGGATCAACGGAGACAGGGAAAACATACTTGAATTGGTTG
AAAACCATCTTAGXX\
Edits in Original Sequence 
(5')XXGGAAGAGATCCATCTTGGCAGAATCGCTGCTTATAAATACAGCACAGCGGCTGCTCTCGAGGAGCCCATCAAGCCTACTGTCAA
TGTGGATCATACTAAACTTTTTATCAACGGGCAATTTGTTGATTCTGCATCAGGAAAAACTTTCCCAACTCTCGACCCCAGGACAGGGGA
GGTAATTGCACATATTGCTGAAGGTGATGCAGAAGATATTAATCGGGCAGTAGCTGCTGCTCGTAAGGCTTTTGATGAAGGACCGTGGCC
TAGGATGACTGCTTATGAAAGGTCAAAGATATTGCTGCGCCTTGCTGATCTGATTGAAAAACATAATGATCAAATTGCAACACTCGAGAC
TTGGGACACTGGGAAGCCTTATGCACAAGCTGCTAAGATTGAAGTACCAATGGTTGTACGTCTACTCCGTTATTATGCTGGCTGGGCAGA
TAAAATTCATGGTATGACCATTCCTGCCGATGGACCATATCATGTTCAAACGTTGCATGAACCGATTGGGGTTGCTGGTCAGATTATCCC
ATGGAATTTTCCTCTCCTCATGTTTTCTTGGAAGATTGGCCCTGCTTTAGCTTGTGGTAACACAATCGTGCTAAAGATGGCTGAGCAGAC
CCCATTATCTGCATTGTATGTAGCAAATCTATTGCAGGAGGCTGGCCTGCCTGAAGGTGTTCTGAATATCATTTCTGGTTTTGGTGCCAC
AGCTGGGTGCTTCCTCTCTGTAGTCATATTGGATGTGGATAAAGCtTGCTTTTACTGGATCAACGGAGACAGGGAAAACATACTTGAATT
GGTTGAAAACCATCTTAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan