ESTScan Details for Unigene SGN-U296884

Score 
159
Direction 
Forward
Predicted Peptide Sequence 
PDEYDSQLEKFKATXLRRLGSSSNFASFAMPLKYSLFNVTARRFPSYPPYPXKSTGIRGGKLAERNRVFAPTLVLEMLKWDAVP
Predicted Coding Sequence 
XCTCCAGATGAGTATGATAGTCAATTGGAGAAATTTAAGGCTACCAAXTTGAGAAGACTTGGTTCCTCTTCAAATTTTGCATCATTTGCT
ATGCCTCTGAAGTACTCTTTGTTCAATGTTACTGCCCGTCGCTTCCCTTCTTATCCTCCTTACCCTXCTAAATCAACAGGAATAAGAGGT
GGGAAACTAGCAGAAAGGAATAGAGTTTTCGCACCAACCCTAGTCTTAGAAATGTTAAAATGGGATGCAGTTCCTTAG\
Edits in Original Sequence 
(5')XCTCCAGATGAGTATGATAGTCAATTGGAGAAATTTAAGGCTACCAAXTTGAGAAGACTTGGTTaCCTCTTCAAATTTTGCATCAT
TTGCTATGCCTCTGAAGTACTCTTTGTTCAATGTTACTGCCCGTCGCTTCCCTTCTTATCCTCCTTACCCTXCTAAATCAACAGGAATAA
GAGcGTGGGAAACTAGCAGAAAGGAATAGAGTTTTCGCACCAACCCTAGTCTTAGAAATGTTAAAATGGGATGCAGTTCCTTAG\(3')G
GTTTTGGTTAAAGATTACTACAGAGTGTATTCTATTTTGACAAAATAAAGGCAGTCTAGCGATAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan