ESTScan Details for Unigene SGN-U296894

Score 
457
Direction 
Forward
Predicted Peptide Sequence 
ETPCPPSSVAVEXGLKKLHFAYGYCXPEPRNRPKMGDLLESDFLNAPRDEFEEREAAIQLREEIEEQEXIAGIPFANSTAKAGGFAQLAE
IVSFLSSDIEEVSKMQKTFRDKRDSNQEPVKDSGSGKINIAEDDEAGCFASRKRFRPGLSIHTAEEYNGNPDESEKHVENKGSILAKNPR
LMKNFRKLEAAYFX
Predicted Coding Sequence 
GAGACACCGTGTCCTCCCTCCTCAGTTGCTGTTGAAAXTGGCCTAAAGAAGCTTCATTTTGCTTATGGTTACTGCAXCCCCGAGCCGAGA
AATAGGCCAAAAATGGGTGACTTGCTAGAAAGTGACTTCCTTAATGCTCCAAGAGATGAGTTTGAAGAACGTGAAGCAGCAATACAGCTT
AGAGAAGAAATAGAGGAGCAAGAGXTTATTGCTGGAATTCCTTTTGCTAATTCAACAGCGAAAGCAGGAGGCTTTGCACAACTTGCTGAG
ATTGTATCTTTTTTATCATCTGACATAGAAGAGGTCTCAAAGATGCAGAAAACCTTCAGAGACAAAAGGGATTCAAATCAGGAGCCAGTA
AAGGATTCAGGTTCGGGGAAGATAAATATTGCTGAAGATGATGAAGCTGGGTGCTTTGCATCTAGAAAGAGATTTAGGCCAGGCCTTTCA
ATACACACAGCTGAGGAATACAATGGCAATCCAGATGAGTCTGAGAAACATGTCGAAAACAAAGGGAGCATTCTAGCAAAAAATCCCCGG
TTGATGAAGAACTTCAGGAAATTAGAGGCAGCTTACTTCATX\
Edits in Original Sequence 
(5')GAGACACCGTGTCCTCCCTCCTCAGTTGCTGTTGAAAXTGGCCTAAAGAAGCTTCATTTTGCTTATGGTTACTGCAXCCCCGAGCC
GAGAAATAGGCCAAAAATGGGTGACTTGCTAGAAAGTGACTTCCTTAATGCTCCAAGAGATGAGTTTGAAGAACGTGAAGCAGCAATACA
GCTTAGAGAAGAAATAGAGGAGCAAGAGXTTATTGCTGGAATTCCTTTTGCTAATTCAACAGCGAAAGCAGGAGGCTTTGCACAACTTGC
gTGAGATTGTATCTTTTTTATCATCTGACATAGAAGAGGTCTCAAAGATGCAGAAAACCTTCAGAGACAAAAGGGATTCAAATCAGGAGC
CAGTAAAGGATTCAGGTTCGGGGAAGATAAATATTGCTGAAGATGATGAAGCTGGGTGCTTTGCATCTAGAAAGAGATTTAGGCCAGGCC
TTTCAATACACACAGCTGAGGAATACAATGGCAATCCAGATGAGTCTGAGAAACATGTCGAAAACAAAGGGAGCATTCTAGCAAAAAATC
CCCGGTTGATGAAGAACTTCAGGAAATTAGAGGCAGCTTACTTCATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan