ESTScan Details for Unigene SGN-U296970

Score 
386
Direction 
Forward
Predicted Peptide Sequence 
ECETFCAVTFDYPTEFLTSISGSFRKAYGYSILSSISFGTNMGSYGPFGTPTTDANKFTFKMGNYPSFGGFHGSKHHHGVESFGVYMKPI
TTSMIHFKDPPVKVKKEGVQEKKV
Predicted Coding Sequence 
XXTGAATGTGAAACCTTTTGTGCAGTGACATTTGATTATCCAACAGAGTTTCTTACTTCCATAAGTGGTTCATTCCGAAAAGCTTATGGA
TATTCTATTTTGAGCTCAATATCATTTGGAACCAATATGGGTTCCTATGGACCATTTGGAACCCCGACAACTGATGCTAACAAATTCACC
TTTAAGATGGGAAATTATCCTTCTTTTGGTGGTTTTCACGGCAGCAAACACCATCATGGTGTTGAGAGTTTTGGAGTCTATATGAAGCCC
ATCACAACCTCAATGATCCATTTTAAAGATCCTCCAGTAAAGGTTAAAAAGGAAGGAGTTCAAGAGAAGAAGGTCTAA\
Edits in Original Sequence 
(5')XXTGAATGTGAAACCTTTTGTGCAGTGACATTTGATTATCCAACAGAGTTTCTTACTTCCATAAGTGGTTCATTCCGAAAAGCTTA
TGGATATTCTATTTTGAGCTCAATATCATTTGGAACCAATATGGGTTCCTATGGACCATTTGGAACCCCGACAACTGATGCTAACAAATT
CACCTTTAAGATGGGAAATTATCCTTCTTTTGGTGGTTTTCACGGCAGCAAACACCATCATGGTGTTGAGAGTTTTGGAGTCTATATGAA
GCCCATCACAACCTCAATGATCCATTTTAAAGATCCTCCAGTAAAGGTTAAAAAGGAAGGAGTTCAAGAGAAGAAGGTCTAA\(3')CTC
AAGCTGCATACCCTTTCACAAATTTCTGAATAATGCAGTTCGTATTAATTTTCTCTATTGCTTATGGTTGTTTCTACTTTTCATATCAAT
TTCAGTTGGTGTTACTTGCTATATGAGAACAGTTTTCCTACTCTAAAAGTTGGATATAAAGAAACAAAAAGCAAGCACGAAAAAAAAGAA
AG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan