ESTScan Details for Unigene SGN-U296972

Score 
79
Direction 
Reverse
Predicted Peptide Sequence 
DNDMNAKISDFGIARCHEEDGNEAMTNRVIGTYGYLSPEYALYGQYSVKSDVYSFGILVLEIVSGKSNRRFAPSNLNRSLIGHAWELNKE
GRSIELLDERVGDSCSTPQEVVRSIGVGLLCVQERPDDRPSMSSVVLMLNNEGTLPQAKLPAFYMEGDASDTELHSSQFAHSTTDDTPLD
IR
Predicted Coding Sequence 
XXAGACAATGATATGAATGCAAAGATATCAGACTTTGGTATAGCAAGATGCCATGAAGAGGATGGTAATGAAGCCATGACAAACCGAGTT
ATTGGAACATACGGGTACCTCTCACCAGAATATGCGCTATATGGGCAATACTCTGTAAAATCAGATGTGTATAGCTTTGGTATCTTAGTA
CTGGAAATTGTGAGTGGAAAAAGCAACAGACGATTCGCTCCTTCAAACCTTAACCGTAGTCTAATCGGGCATGCATGGGAACTCAACAAG
GAAGGGAGGTCAATAGAACTACTTGATGAACGCGTAGGTGATTCTTGTTCTACACCTCAAGAAGTGGTACGATCAATTGGTGTTGGTCTA
TTATGTGTCCAAGAACGTCCAGATGATCGTCCAAGTATGTCTTCCGTAGTTCTAATGTTAAACAATGAAGGTACGCTGCCTCAGGCTAAA
CTACCAGCTTTTTACATGGAAGGAGATGCATCAGATACTGAATTACATTCTAGCCAATTTGCACATAGTACAACGGATGACACCCCGTTA
GATATTAGATGA\
Edits in Original Sequence 
(5')XXAGACAATGATATGAATGCAAAGATATCAGACTTTGGTATAGCAAGATGCCATGAAGAGGATGGTAATGAAGCCATGACAAACCG
AGTTATTGGAACATACGGGTACCTCTCACCAGAATATGCGCTATATGGGCAATACTCTGTAAAATCAGATGTGTATAGCTTTGGTATCTT
AGTACTGGAAATTGTGAGTGGAAAAAGCAACAGACGATTCGCTCCTTCAAACCTTAACCGTAGTCTAATCGGGCATGCATGGGAACTCAA
CAAGGAAGGGAGGTCAATAGAACTACTTGATGAACGCGTAGGTGATTCTTGTTCTACACCTCAAGAAGTGGTACGATCAATTGGTGTTGG
TCTATTATGTGTCCAAGAACGTCCAGATGATCGTCCAAGTATGTCTTCCGTAGTTCTAATGTTAAACAATGAAGGTACGCTGCCTCAGGC
TAAACTACCAGCTTTTTACATGGAAGGAGATGCATCAGATACTGAATTACATTCTAGCCAATTTGCACATAGTACAACGGATGACACCCC
GTTAGATATTAGATGA\(3')AAAACAGAGAACACTAGTTAACTTGTTTGAAACAATTTCTTTCCAAGCTTGCAGTCTAACAAAATATAG
TTAACCCTTCCTCTCAGAAAATATATTTGACATTTTTCCAAAAAAAGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan