ESTScan Details for Unigene SGN-U297001

Score 
354
Direction 
Forward
Predicted Peptide Sequence 
EILTNLLFLTNTESSNFFEVSANXQELSKMLSRIAKIPLVSSHPEVYEPCDDSFALVDALLADRTNLLQHKPSICMEIGCGSGYVITSLA
VMLGHEGFVPYHIATDINPHAIRVTRETMDAHGVYAELVNTDITSGLEKRLAGSVDVLVVNPPYVPTPEEKFGFEGITSAWAGGENGEVS
LDKILAVADDLSSEKGW
Predicted Coding Sequence 
GAAATTCTTACAAATCTTTTGTTTCTAACAAATACTGAAAGTTCCAATTTTTTTGAGGTTTCAGCAAATXCACAGGAGTTATCTAAGATG
CTTTCAAGAATTGCGAAAATCCCACTTGTGAGTTCACATCCTGAGGTTTACGAACCATGTGATGATTCGTTTGCATTGGTCGATGCTTTA
TTAGCTGATCGAACTAACTTGTTACAACACAAACCCTCAATTTGTATGGAAATTGGTTGTGGTAGTGGTTACGTTATTACTTCACTTGCT
GTTATGCTTGGACACGAAGGATTTGTTCCATACCATATTGCAACAGACATCAACCCTCATGCAATAAGGGTGACTCGTGAGACCATGGAT
GCTCATGGGGTTTATGCAGAGTTGGTAAACACTGATATTACATCTGGACTTGAGAAGCGATTGGCAGGATCAGTTGATGTGCTGGTTGTG
AACCCTCCTTATGTTCCTACGCCTGAAGAGAAGTTTGGTTTTGAAGGCATCACTTCGGCATGGGCTGGAGGGGAGAATGGTGAAGTGTCA
CTTGATAAAATACTGGCTGTTGCCGACGATCTNTCGTCAGAGAAGGGCTGG\
Edits in Original Sequence 
(5')GAAATTCTTACAAATCTTTTGTTTCTAACAAATACTGAAAGTTCCAATTTTTTTGAGGTTTCAGCAAATXCACAGGAGTTATCTAA
GATGCTTTCAAGAATTGCGAAAATCCCACTTGTGAGTTCACATCCTGAGGTTTACGAACCATGTGATGATTCGTTTGCATTGGTCGATGC
TTTATTAGCTGATCGAACTAACTTGTTACAACACAAACCCTCAATTTGTATGGAAATTGGTTGTGGTAGTGGTTACGTTATTACTTCACT
TGCTGTTATGCTTGGACACGAAGGATTTGTTCCATACCATATTGCAACAGACATCAACCCTCATGCAATAAGGGTGACTCGTGAGACCAT
GGATGCTCATGGGGTTTATGCAGAGTTGGTAAACACTGATATTACATCTGGACTTGAGAAGCGATTGGCAGGATCAGTTGATGTGCTGGT
TGTGAACCCTCCTTATGTTCCTACGCCTGAAGAcGAAGTTTGGTTTTGAAGGCATCACTTCGGCATGGGCTGGAGGGGAGAATGGTcGAA
GTGTCACTTGATAAAATACTGGCTGTTGCCGACGATCTNTCGTCAGAGAAGGGCTGG\(3')TTATATATAGGTCCACGCTCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan