ESTScan Details for Unigene SGN-U297278

Score 
183
Direction 
Forward
Predicted Peptide Sequence 
MKHQKKKKRSKACKQVGVGNGSLPSGNSNDGEESVVTALTDAFSSVSVEEATCAYKXGKWGLNKAMEDLGDMVER
Predicted Coding Sequence 
ATGAAGCATCAGAAGAAGAAGAAGAGATCCAAAGCTTGTAAACAAGTTGGGGTTGGTAACGGTTCGTTGCCATCTGGGAATAGTAATGAT
GGAGAGGAGAGTGTTGTGACGGCTTTAACGGACGCATTTAGCTCTGTATCTGTGGAGGAAGCAACATGTGCTTATAAAGAXGGCAAATGG
GGATTGAATAAAGCAATGGAAGATCTGGGTGATATGGTGGAGCGT\
Edits in Original Sequence 
CTTTGCTTGGTGAAATTTGGAAACCGCAATTATTGCATTAAAATAGTCAACCTTACCGGATTTTAAATTCAAATTCGATTTGTTGATTGT
TGTTTTTGCATAATTATCCTCCATTGTTGTGCAGAATTTGTCTGCGAAGAGCTGATCATTTTGAATCATGTAATTAGGGTTTTCAGTAAA
ATTTTCAGTTTCTCAGAAGCTTCTCCAATCACGATCTCCTTATAGATAAGTTGAATTTTTTTCCCTTGATCAAAGTGTTTGATTTTGCTC
AGAAAGTGCATACCCAGAAGCTGAAATCTCGTAAATTAATGATTCTGGGTTCAGATTTTGTTGTATGTATTTTTTGTATGTAGTTTTGTA
ATCTAGTAACAAAATTGTGTATCTTGTGAGCGAGGTGTGTGCAAGCTGGCTCGGACACCAAGGTTATTAAAAAAAAGAAAATTGTGTGTC
TTGTGGTTAGTCTTGTAAGATTTTTTGTATATGATTGATTAGTTAATAACTAGAAAT
(5')ATGAAGCATCAGAAGAAGAAGAAGAGATC
CAAAGCTTGTAAACAAGTTGGGGTTGGTAACGGTTCGTTGCCATCTGGGAATAGTAATGATGGAGAGGAGAGTGTTGTGACGGCTTTAAC
GGACGCATTTAGCTCTGTATCTGTGGAGGAAGCAACATGTGCTTATAAAGAXGGCAAATGGGGATTGAATAAAGCAATGGAAGATCTGGG
TGATATGGTGGAGCGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan