ESTScan Details for Unigene SGN-U297336

Score 
602
Direction 
Forward
Predicted Peptide Sequence 
MPTLTKLFTMEEAAEHNTKDDCWVVIDGKVYDVSSYLDEHPGGDDVLLGVTGQDATDEFEDAGHSKSARELMEKFFIGELDTTSSSIPEL
EIVKKAGKDIPQKFMEVIKQYWFVPVAAVGISXGGRLLVHTQEVKSVRYSILDVSNIVQHRXEIFFRHIFGGPGILGHDIGECPFLLLFE
MTRKFSTPKLSQIVAIIL
Predicted Coding Sequence 
ATGCCAACTTTAACGAAGTTATTCACAATGGAAGAAGCTGCTGAGCACAACACTAAGGATGATTGTTGGGTCGTCATTGACGGCAAGGTA
TATGATGTTTCATCATATTTAGATGAACATCCTGGGGGAGATGATGTTCTACTTGGTGTTACAGGACAAGATGCCACTGATGAATTTGAA
GATGCTGGACATAGCAAAAGTGCGAGAGAACTTATGGAGAAATTCTTCATTGGGGAGCTTGATACAACATCCTCTTCCATCCCCGAACTT
GAGATTGTCAAGAAGGCGGGCAAAGATATTCCTCAGAAGTTTATGGAAGTTATTAAGCAATATTGGTTCGTTCCAGTAGCAGCTGTTGGC
ATCTCTAXTGGTGGTCGGCTTCTTGTACACACGCAAGAAGTAAAATCAGTTCGATATTCCATCTTAGATGTTAGTAATATTGTGCAACAT
AGAXCTGAAATTTTTTTTCGTCATATCTTTGGAGGTCCAGGAATTTTGGGACATGATATTGGTGAATGCCCATTTTTGTTACTGTTTGAG
ATGACACGGAAATTTTCAACACCAAAATTATCACAAATAGTTGCTATCATTTTGTAG\
Edits in Original Sequence 
TGAGAAATTTTGCAAGTAAAA(5')ATGCCAACTTTAACGAAGTTATTCACAATGGAAGAAGCTGCTGAGCACAACACTAAGGATGATTG
TTGGGTCGTCATTGACGGCAAGGTATATGATGTTTCATCATATTTAGATGAACATCCTGGGGGAGATGATGTTCTACTTGGTGTTACAGG
ACAAGATGCCACTGATGAATTTGAAGATGCTGGACATAGCAAAAGTGCGAGAGAACTTATGGAGAAATTCTTCATTGGGGAGCTTGATAC
AACATCCTCTTCCATCCCCGAACTTGAGATTGTCAAGAAGGCGGGCAAAGATATTCCTCAGAAGTTTATGGAAGTTATTAAGCAATATTG
GTTCGTTCCAGTAGCAGCTGTTGGCATCTCTAXTGGTGGTCGGCTTCTTGTACACACGCAAGAAGTAAAATCAGTTCGATATTCCATCTT
AGATGTTAGTAATATTGTGCAACATAGAXCTGAAATTTTTTTTCGTCATATCTTTGGAGGTCCAGGAATTTTGGGACATGATATTGGTGA
ATGCCCATTTTTGTTACTGTTTGAGATGACACGGAAATTTTCAACACCAAAATTATCACAAATAGTTGCTATCATTTTGTAG\(3')TTG
ATAAAGAGTTTTTCATTTATTAGCTTTTTGAGGATATATTATAAAGGCCTCAGAAAGGACATCCTACTTTCTTCTCTTTTAAAAAAACAA
A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan