Notice: SGN will be briefly unavailable for maintenance. Apologies.

ESTScan Details for Unigene SGN-U297348

Score 
403
Direction 
Reverse
Predicted Peptide Sequence 
SGGWTVAGTQLNLNDPRLLSMAITERQLHEAKRDEYVDASASGAAFCRSAALFLMALLLLRDAFENGEGDDEDVSAFFSLFLLRAAGFLL
PCFIMAWGISILQRRRQRQDRGFAGFHKFSEGY
Predicted Coding Sequence 
AGTGGTGGCTGGACAGTGGCTGGCACTCAGCTCAATTTAAATGACCCTCGACTTCTTTCGATGGCTATCACAGAACGCCAGCTTCATGAG
GCTAAACGTGACGAATATGTTGATGCAAGTGCTAGTGGAGCTGCATTTTGTCGTTCCGCTGCTTTGTTTTTAATGGCCCTCCTCTTACTG
AGGGATGCTTTTGAAAATGGCGAAGGTGATGACGAGGATGTTTCCGCTTTTTTCTCTCTCTTTTTGCTCCGTGCTGCTGGTTTTCTTTTA
CCTTGCTTCATCATGGCTTGGGGTATCAGTATATTGCAGCGTCGAAGACAAAGACAGGATAGAGGTTTTGCTGGTTTTCATAAATTCTCA
GAAGGCTATTAA\
Edits in Original Sequence 
(5')AGTGGTGGCTGGACAGTGGCTGGCACTCAGCTCAATTTAAATGACCCTCGACTTCTTTCGATGGCTATCACAGAACGCCAGCTTCA
TGAGGCTAAACGTGACGAATATGTTGATGCAAGTGCTAGTGGAGCTGCATTTTGTCGTTCCGCTGCTTTGTTTTTAATGGCCCTCCTCTT
ACTGAGGGATGCTTTTGAAAATGGCGAAGGTGATGACGAGGATGTTTCCGCTTTTTTCTCTCTCTTTTTGCTCCGTGCTGCTGGTTTTCT
TTTACCTTGCTTCATCATGGCTTGGGGTATCAGTATATTGCAGCGTCGAAGACAAAGACAGGATAGAGGTTTTGCTGGTTTTCATAAATT
CTCAGAAGGCTATTAA\(3')CATGTGTATCTTCATTCTTGCAATTCTAGTGATATATGTTTATGCATAATGCAAAAGGCTTGTGCAAAA
TGATGTGTGTGTTTGAATAATATTTATACATTAATGCCTTGCGAAGCGCTGGGCCCATGCATTTGTAATTTAAAAACTAGTCTAAAGTTG
GAGTAGTTATCGCTTATTAATGCTCCATGGTAAACCAGCTATAGTGATGAACATCTTTTGCTGTCTAAAAAAAAGGATTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan