ESTScan Details for Unigene SGN-U297464

Score 
288
Direction 
Forward
Predicted Peptide Sequence 
IAGTSGADNIFHRDFSAPAGEDKLDKSILPKVMXVKHFGRSGRQNGRILSMRTQLIGTTRGHTMTLFGAKYNTKMAAVNAPIAKPKGXKI
EGLGDPVKSIVVWFLFVLMVQPAFRLFEAXALTFCFALCIQMSSVALVKLYEWQRSTFWYQFQELSNCLLIETFMH
Predicted Coding Sequence 
XAAATAGCTGGAACTTCTGGCGCTGATAATATATTTCACCGTGATTTCTCTGCACCAGCAGGGGAGGATAAGTTGGATAAATCCATACTA
CCAAAAGTCATGCANGTCAAACATTTTGGTCGCAGTGGAAGACAAAATGGACGCATCTTGTCAATGAGGACACAACTGATTGGAACAACC
CGTGGACATACAATGACTCTCTTCGGXGCCAAGTATAATACAAAAATGGCTGCTGTTAATGCTCCTATTGCAAAGCCTAAGGGTAAXAAA
ATTGAAGGATTGGGAGACCCGGTGAAGTCTATTGTAGTCTGGTTCTTGTTTGTGCTCATGGTTCAGCCAGCTTTCAGGTTGTTTGAAGCA
XCTGCACTGACTTTCTGTTTTGCTCTTTGCATTCAAATGTCATCTGTAGCTCTTGTGAAGTTATATGAATGGCAGAGAAGCACATTCTGG
TATCAGTTTCAGGAATTATCCAATTGTCTCCTTATTGAAACATTCATGCATTAG\
Edits in Original Sequence 
(5')XAAATAGCTGGAACTTCTGGCGCTGATAATATATTTCACCGTGATTTCTCTGCACCAGCAGGGGAGGATAAGTTGGATAAATCCAT
ACTACCAAAAGTCATGCANGTCAAACATTTTGGTCGCAGTGGAAGACAAAATGGACGCATCTTGTCAATGAGGACACAACTGATTGGAAC
AACCCGTGGACATACAATGACTCTCTTCGGXGCCAAGTATAATACAAAAATGGCTGCTGTTAATGCTCCTATTGCAAAGCCTAAGGGTAA
XAAAATTGAAGGATTGGGAGACCCGGTGAAGTCgTATTGTAGTCTGGTTCTTGTTTGTGCTCATGGTTCAGCCAGCTTTCAGGTTGTTTG
AAGCAXCTGCACTGACTTTCTGTTTTGCTCTTTGCATTCAAATGTCATCTGTAGCTCTTGTGAAGTTATATGAATGGCAGAGAAGCACAT
TCTGGTATCAGTTTCAGGAATTATCCAATTGTCTCCTTATTGAAACATTCATGCATTAG\(3')GTATAGATTGCATTTCGCTTTTTAGT
TATTGAGATATTCTATACTAAAAACATGAACAGAACTTGTTCTCTGTATCGTCACTATGCTCAACTAAAATCATGAGTAGAACTTGTTGT
TGTGGATACCATAGTGTTCATTTTCTTGGCTGTTCTTGTGCCAGTGCGGGGTTCTTTTTTACTAAAAGGGGAAACCCCCTTTTCCCTTAA
AAGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan