ESTScan Details for Unigene SGN-U297497

Score 
177
Direction 
Reverse
Predicted Peptide Sequence 
EAPEIGCPPDEALYNTLRARYGINGGRARALKMVSEMIEKGVDPDEXNVSNALISCLCRDGMVNEALDLLGDMEGNGFPPTVITYNILLL
GLCKAHRVVEAIEVLAEMVEKGRRPNETNYILLIEGIGFSGRRVQAMEMASAIYHKNAISKESLQRLRKTFQVPDVYNKDITTILRNQKI
VS
Predicted Coding Sequence 
XGAGAAGCTCCGGAAATAGGATGTCCTCCTGATGAAGCACTTTATAATACATTGAGAGCGCGTTATGGAATAAATGGAGGGAGAGCTAGG
GCCTTGAAAATGGTATCAGAGATGATAGAAAAAGGCGTTGATCCTGATGAGATXAACGTTAGTAATGCATTGATTTCATGTTTATGTAGA
GATGGGATGGTAAATGAAGCACTTGATTTGTTAGGAGATATGGAAGGGAATGGTTTTCCACCTACTGTTATAACTTATAACATTCTTCTT
CTTGGACTATGCAAAGCTCATAGAGTTGTTGAGGCAATTGAAGTTCTAGCAGAGATGGTAGAAAAGGGGCGTCGTCCAAATGAAACCAAC
TATATTCTGTTGATTGAAGGTATTGGTTTTTCAGGACGGAGAGTTCAAGCAATGGAGATGGCTAGCGCGATTTATCATAAGAATGCTATC
TCGAAAGAATCACTTCAACGTTTGAGAAAAACCTTTCAAGTACCTGATGTTTATAATAAAGATATTACTACTATCTTAAGAAACCAGAAA
ATAGTTTCTTGA\
Edits in Original Sequence 
(5')XGAGAAGCTCCGGAAATAGGATGTCCTCCTGATGtAAGCACTTTATAATACATTGAtGAGCGCGTTATGGAATAAATGGAGGGAGA
GCTAGGGCCTTGAAAATGGTATCAGAGATGATAGAAAAAGGCGTTGATCCTGATGAGATXAACGTTAGTAATGCATTGATTTCATGTTTA
TGTAGAGATGGGATGGTAAATGAAGCACTTGATTTGTTAGGAGATATGGAAGGGAATGGTTTTCCACCgTACTGTTATAACTTATAACAT
TCTTCTTCTTGGACTATGCAAAGCTCATAGAGTTGTTGAGGCAATTGAAGTTCTAGCAGAGATGGTAGAAAAGGGGCGTCGTCCAAATGA
AACCAACgTATATTCTGTTGATTGAAGGTATTGGTTTTTCAGGACGGAGAGTTCAAGCAATGGAGATGGCTAGCGCGATTTATCATAAGA
ATGCTATCTCGAAAGAATCACTTCAACGTTTGAGAAAAACCTTTCAAGTACCTGATGTTTATAATAAAGATATTACTACTATCTTAAGAA
ACCAGAAAATAGTTTCTTGA\(3')ATCTGTTTCTGATATGTTCTTCTCTGTATCGTTCCAATTTTATCATAAAGTCCACGAAGGGACAC
GTTTCGTTCAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan