ESTScan Details for Unigene SGN-U297678

Score 
388
Direction 
Reverse
Predicted Peptide Sequence 
PCXQGXKNXXVSECXGDDVQDVSATQGGVEVPNVTTAQSSKRAGNTRRQAGRVTKDVGKLDLNVEFSNEVEEPPAPGMGQGNGAGTGEDG
NIEGIEFFEGLDEFLSSLPILNAVGDDKVKAA
Predicted Coding Sequence 
CCCTGTANCCAAGGGANNAAAAATNNGNTTGTTAGTGAATGCNNTGGTGATGATGTGCAAGATGTTTCAGCGACTCAAGGGGGTGTAGAA
GTGCCCAATGTTACAACAGCTCAGTCTAGCAAAAGAGCTGGTAACACAAGAAGGCAAGCTGGAAGGGTTACCAAAGATGTTGGGAAGTTG
GATTTGAATGTTGAATTCAGTAATGAGGTTGAAGAGCCCCCTGCACCTGGGATGGGCCAAGGCAATGGAGCTGGAACAGGGGAGGATGGG
AACATTGAAGGGATTGAGTTTTTTGAAGGTCTTGATGAATTCCTAAGCAGTCTTCCTATACTCAATGCTGTGGGTGATGATAAGGTTAAG
GCTGCCTAG\
Edits in Original Sequence 
(5')CCCTGTANCCAAGGGANNAAAAATNNGNTTGTTAGTGAATGCNNTGGTGATGATGTGCAAGATGTTTCAGCGACTCAAGGGGGTGT
AGAAGTGCCCAATGTTACAACAGCTCAGTCTAGCAAAAGAGCTGGTAACACAAGAAGGCAAGCTGGAAGGGTTACCAAAGATGTTGGGAA
GTTGGATTTGAATGTTGAATTCAGTAATGAGGTTGAAGAGCCCCCTGCACCTGGGATGGGCCAAGGCAATGGAGCTGGAACAGGGGAGGA
TGGGAACATTGAAGGGATTGAGTTTTTTGAAGGTCTTGATGAATTCCTAAGCAGTCTTCCTATACTCAATGCTGTGGGTGATGATAAGGT
TAAGGCTGCCTAG\(3')CGAAGTAAGGCATTTCTTTTGTTCTAGTTGTAGCTTCCTTTTGTCTTTTGTATGTTTTAGTAAGGGATGAAA
AGCTACTCAGGCATTGGCCTTGATGTTTTCATTGTAATGCTAATGTATTGCTAGTTTGCATTGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan