ESTScan Details for Unigene SGN-U297757

Score 
339
Direction 
Reverse
Predicted Peptide Sequence 
PSELASLTFLAALNLLFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPFNNSCQSNDSESLPPPTLLPDSDDEWMFIFAAVGYVVGAANT
ISLLWFYEPVQKWFDKHRRNACFGFKESDH
Predicted Coding Sequence 
XTCCCATCAGAGCTTGCAAGTCTCACATTTTTAGCAGCTTTGAACTTATTGTTCAACAAATTGTTTGGCAAAATCCCATCGACCAATCAG
TTTCAAACATTTTCAGCAGATTCCTTTGAAGGAAACAGTGGCCTATGCGGACTCCCTTTCAACAACAGTTGTCAAAGCAATGACTCAGAG
TCCCTGCCGCCACCAACTTTGTTACCAGACTCAGATGATGAATGGATGTTCATTTTTGCAGCTGTTGGATACGTAGTAGGGGCAGCAAAC
ACCATTTCACTTTTGTGGTTTTACGAGCCAGTGCAGAAATGGTTTGATAAGCATAGGAGAAATGCTTGCTTTGGTTTTAAAGAAAGTGAT
CATTAA\
Edits in Original Sequence 
(5')XTCCCATCAGAGCTTGCAAGTCTCACATTTTTAGCAGCTTTGAACTTATTGTTCAACAAATTGTTTGGCAAAATCCCATCGACCAA
TCAGTTTCAAACATTTTCAGCAGATTCCTTTGAAGGAAACAGTGGCCTATGCGGACTCCCTTTCAACAACAGTTGTCAAAGCAATGACTC
AGAGTCCCTGCCGCCACCAACTTTGTTACCAGACTCAGATGATGAATGGATGTTCATTTTTGCAGCTGTTGGATACGTAGTAGGGGCAGC
AAACACCATTTCACTTTTGTGGTTTTACGAGCCAGTGCAGAAATGGTTTGATAAGCATAcGGAGAAATGCTTGCTTTGGTTTTAAAGAAA
GTGATCATTAA\(3')ACCCATAAATGATGAGTTTATTTAATCCTTGCTTTGTTATAATAAACATCAAGATCCAAATTCAAGTCACTTTG
TTATTTCCCTTGATGAATGTATAAAATTTTTTACTATCCGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAAAAAAANC
TCGAGGGGGGGCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan