ESTScan Details for Unigene SGN-U297761

Score 
245
Direction 
Forward
Predicted Peptide Sequence 
FILSSIAILVQTVISTNPLSHICSKSENFTANSFYAQNLKNLLGNLYQKHPKQVSQLAQLGKIMIKQMDFLYVAAIFQAIIANLXVLDAS
EELGKRCPYDKEAIIWYDNCLLKYSDKDFLXKIDNMNKFYMWN
Predicted Coding Sequence 
XXATTTATTCTTTCATCCATTGCAATTCTTGTACAAACAGTAATTTCCACAAATCCACTTTCTCATATTTGCTCAAAATCTGAAAATTTC
ACAGCCAATAGTTTCTATGCACAAAATTTGAAAAATCTTTTAGGTAATCTTTACCAAAAACACCCCAAACAGGTTTCTCAACTTGCTCAA
TTGGGCAAAATCATGATCAAACAAATGGACTTTCTCTATGTCGCGGCGATATTTCAAGCAATAATTGCAAATCTTGXTGTATTAGATGCA
AGTGAAGAACTTGGAAAACGTTGTCCTTACGATAAAGAAGCCATCATATGGTATGATAATTGTCTCTTGAAATATTCCGATAAAGATTTC
TTANGGAAAATTGATAATATGAACAAGTTTTACATGTGGAAT\
Edits in Original Sequence 
(5')XXATTTATTCTTTCATCCATTGCAATTCTTGTACAAACAGTAATTTCCACAAATCCACTTTCTCATATTTGCTCAAAATCTGAAAA
TTTCACAGCCAATAGTTTCTATGCACAAAATTTGAAAAATCTTTTAGGTAATCTTTACCtAAAAACACCCCAAACAGGTTTCTCAACTTG
CTCAATTGGGCAAAATCATGATCAAACAAATGGACTTTCTCTATGTCGCGGCGATATTTCAAGCAATAATTGCAAATCTTGXTGTATTAG
ATGCAAGTGAAGAACTTGGAAAACGTTGTCCTTACGATAAAGAAGCCATCATATGGTATGATAATTGTCTCTTGAAATATTCCGATAAAG
ATTTCTTANGGAAAATTGATAATATGAACAAGTTTTACATGTGGAAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan