Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U298017

Score 
166
Direction 
Reverse
Predicted Peptide Sequence 
MSSPPSEYCESGTTSDNGVDVGVGNGEFRQTGHEAFNFSHHLYTSHENNAYTQVTSVTSPLPCNAQTNRTNDIVSVSLRVNQFRVRIDYS
LIKARECILDETSSFSSSSAMKITLGXVNSGVRVSGLGLGLTAAIGGGAAAEEEERRRVDRRKRKARAIAIAVAEADFIEALDERIGDGG
GVRGGXWAAVDGRGSGAHWEKRREDPLD
Predicted Coding Sequence 
ATGTCTTCTCCACCATCGGAATATTGTGAAAGTGGAACCACCTCCGACAACGGCGTCGACGTCGGCGTCGGCAATGGAGAGTTCCGGCAG
ACTGGACACGAAGCATTCAATTTCAGCCACCATCTATACACATCACATGAAAATAATGCTTACACTCAGGTAACATCCGTAACATCTCCG
CTTCCTTGTAATGCACAAACAAATCGAACAAACGACATCGTTTCCGTTTCTCTTCGAGTAAATCAGTTTAGGGTACGAATTGATTACAGC
TTGATCAAGGCCCGCGAATGTATTTTGGATGAAACGTCGTCGTTTTCGTCTTCCTCAGCAATGAAAATTACACTCGGAXATGTAAATTCC
GGTGTTCGGGTTTCGGGTTTGGGATTGGGATTGACGGCGGCGATAGGCGGTGGAGCGGCAGCAGAGGAAGAGGAAAGGAGGAGAGTGGAT
AGGAGGAAGAGGAAGGCTAGGGCAATTGCAATTGCXGTAGCCGAGGCCGATTTTATTGAGGCTCTCGATGAGCGTATTGGTGATGGTGGT
GGTGTTAGAGGTGGTGXTTGGGCCGCCGTAGACGGAAGAGGGAGTGGTGCACATTGGGAGAAGAGAAGAGAAGATCCATTAGATTAA\
Edits in Original Sequence 
TCCAATTTCAAACATCAAAATAAGGGTAAAAAATACATTTAAAATAAATTCTTCAGTGATCA(5')ATGTCTTCTCCgACCATCGGAATA
TTGTGAAAGTGGAACCACCTCCGACAACGGCGTCGACGTCGGCGTCGGCAATGGAGAGTTCCGGCAGACTGGACACGAAGCATTCAATTT
CAGCCACgCATCTATACACATCACATGAAAATAATGCTTACACTCAGGTAACATCCGTAACATCTCCGCTTCCTTGTAATcGCACAAACA
AATCGAACAAACGACATCGTTTCCGTTTCTCTTCGAGTAAATCAGTTTAGGGTACGAATTGATTACAGCTTGATCAAGGCCCGCGAATGT
ATTTTGaGATGAAACGTCGTCGTTTTCGTCTTCCTCAGCAATGAAAATTACACTCGGAXATGTAAATTCCGGTGTTCGGGTTTCGGGTTT
GGGATTGGGATTGACGGCGGCGATAGGCGGTGGAGCGGCAGCAGAGGtAAGAGGAAAGGAGGAGAGTGGATAGGAGGAAGAGGAAGGCTA
GGGCAATTGCAATTGCXGTAGCCGAGGCCGATTTTATTGAGGCTCTCGATGAGCGTATTGGTGATGGTGGTGGTgGTTAGAGGTGGTGXT
TGGGCCGCCGTAGACGGAAGAGGGAGTGGTGCACATTGGGAGAAGAGtAAGAGAAGATCCATTAGATTAA\(3')AGGGGAAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan