ESTScan Details for Unigene SGN-U298052

Score 
629
Direction 
Forward
Predicted Peptide Sequence 
ISGCFNLVSVVLSYNMMVGKIPAELGTLLKLKQLSLVSNYFTGGIPPSFGNLSLLDTFSASKNNLLGKIPDELCQLLNLKYFVVNENNLS
GTLPPCLFNLSSIVAIDVGTNHLEGKLPPLLGITLPSLEFLSIYRNNVTGNIPVTLSNATNLQSLIASRNGLTGKVPPLGNLLKMRRFLV
AFNYLGKGEDDDLSFLTTLVNATSLELLELNTNNFGGVLPASVSNLSTELIELSLSYNQISG
Predicted Coding Sequence 
XXCATTTCAGGATGCTTCAATCTTGTTTCTGTTGTTCTTTCATATAATATGATGGTGGGCAAAATTCCAGCAGAATTAGGCACATTGTTG
AAACTCAAACAACTTTCTCTTGTTTCTAACTATTTTACAGGAGGAATTCCGCCTTCATTTGGTAATCTTTCTTTACTTGATACCTTTTCC
GCAAGCAAGAATAATTTGTTAGGGAAAATACCTGATGAATTATGTCAATTGCTCAACTTAAAGTACTTTGTAGTGAATGAGAACAACTTG
AGTGGTACCCTGCCTCCTTGTCTTTTCAATCTTTCCTCTATCGTGGCCATAGATGTTGGAACAAACCATTTAGAAGGAAAATTGCCTCCA
TTGCTTGGTATTACTCTTCCTAGTTTAGAGTTCCTTAGCATTTATAGAAACAATGTAACTGGAAATATTCCGGTAACATTGTCAAATGCT
ACGAATCTTCAGTCTCTTATTGCTAGTAGAAATGGACTCACAGGAAAAGTACCACCCCTTGGAAATTTGCTGAAAATGCGGAGATTTTTA
GTTGCTTTCAATTATCTTGGGAAGGGGGAGGATGATGACCTTAGCTTTCTCACCACATTGGTGAATGCCACCAGCTTGGAGCTTTTGGAG
CTCAATACAAATAATTTTGGTGGAGTCTTACCTGCATCTGTTAGTAATCTTTCGACTGAGCTTATAGAGCTTTCGTTGTCTTATAATCAG
ATTTCTGGX\
Edits in Original Sequence 
(5')XXCATTTCAGGATGCTTCAATCTTGTTTCTGTTGTTCTTTCATATAATATGATGGTGGGCAAAATTCCAGCAGAATTAGGCACATT
GTTGAAACTCAAACAACTTTCTCTTGTTTCTAACTATTTTACAGGAGGAATTCCGCCTTCATTTGGTAATCTTTCTTTACTTGATACCTT
TTCCGCAAGCAAGAATAATTTGTTAGGGAAAATACCTGATGAATTATGTCAATTGCTCAACTTAAAGTACTTTGTAGTGAATGAGAACAA
CTTGAGTGGTACCCTGCCTCCTTGTCTTTTCAATCTTTCCTCTATCGTGGCCATAGATGTTGGAACAAACCATTTAGAAGGAAAATTGCC
TCCATTGCTTGGTATTACTCTTCCTAGTTTAGAGTTCCTTAGCATTTATAGAAACAATGTAACTGGAAATATTCCGGTAACATTGTCAAA
TGCTACGAATCTTCAGTCTCTTATTGCTAGTAGAAATGGACTCACAGGAAAAGTACCACCCCTTGGAAATTTGCTGAAAATGCGGAGATT
TTTAGTTGCTTTCAATTATCTTGGGAAGGGGGAGGATGATGACCTTAGCTTTCTCACCACATTGGTGAATGCCACCAGCTTGGAGCTTTT
GGAGCTCAATACAAATAATTTTGGTGGAGTCTTACCTGCATCTGTTAGTAATCTTTCGACTGAGCTTATAGAGCTTTCGTTGTCTTATAA
TCAGATTTCTGGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan