ESTScan Details for Unigene SGN-U298141

Score 
361
Direction 
Forward
Predicted Peptide Sequence 
NKLAAASPGLGSNKLGSREGRVIGSLQAVSVEMTIFFLLHLFLIIIVLLAMVGEGAYNCSVSRCGSDGPRIHFPFRLHHQPEYCGYPGFE
LSCDRENQTILTLPNSLTLIVREIDYMSQQIRLSDPERCLILKLLHLNLSESPFSFTVADPYHTLENISIFNCSGMPADYYYSDCASDKT
IFAVSYSFDLPPEATCKKIHEIPVISLQYNLQFE
Predicted Coding Sequence 
AAXAACAAATTAGCTGCTGCCTCACCAGGTTTGGGGAGTAATAAACTTGGTAGTAGAGAAGGCCGTGTCATAGGGAGTCTACAAGCCGTG
TCAGTCGAGATGACCATCTTTTTCCTCTTGCACTTATTTCTCATCATCATAGTATTGTTGGCTATGGTTGGTGAAGGAGCATATAATTGC
AGTGTCTCCAGGTGTGGAAGTGATGGCCCTAGAATTCATTTTCCCTTCAGGCTTCACCACCAGCCAGAATATTGTGGTTATCCAGGCTTC
GAGTTATCTTGTGACCGCGAAAACCAAACCATACTCACACTTCCCAATTCACTTACACTAATTGTTCGAGAAATTGATTATATGTCTCAG
CAGATTAGGCTTTCTGATCCTGAACGTTGTCTCATTCTCAAGCTATTGCACCTTAATTTATCAGAATCTCCTTTCTCCTTCACTGTTGCC
GATCCTTATCATACACTAGAAAACATTTCAATTTTCAACTGTTCTGGTATGCCAGCAGATTACTACTATTCAGATTGTGCCTCTGACAAA
ACAATATTTGCTGTTTCCTACTCTTTTGATTTACCCCCCGAGGCAACTTGCAAAAAGATTCATGAAATTCCXGTCATTTCTCTACAATAC
AATTTACAGTTCGAATAA\
Edits in Original Sequence 
(5')AAXAACAAATTAGCTGCTGCCTCACCAGGTTTGGGGAGTAATAAACTTGGTAGTAGAGAAGGCCGTGTCATAGGGAGTCTACAAGC
CGTGTCAGTCGAGATGACCATCTTTTTCCTCTTGCACTTATTTCTCATCATCATAGTATTGTTGGCTATGGTTGGTGAAGGAGCATATAA
TTGCAGTGTCTCCAGGTGTGGAAGTGATGGCCCTAGAATTCATTTTCCCTTCAGGCTTCACCACCAGCCAGAATATTGTGGTTATCCAGG
CTTCGAGTTATCTTGTGACCGCGAAAACCAAACCATACTCACACTTCCCAATTCACTTACACTAATTGTTCGAGAAATTGATTATATGTC
TCAGCAGATTAGGCTTTCTGATCCTGAACGTTGTCTCATTCTCAAGCTATTGCACCTTAATTTATCAGAATCTCCTTTCTCCTTCACTGT
TGCCGATCCTTATCATACACTAGAAAACATTTCAATTTTCAACTGTTCTGGTATGCCAGCAGATTACTACTATTCAGATTGTGCCTCTGA
CAAAACAATATTTGCTGTTTCCTACTCTTTTGATTTACCCCCCGAGGCAACTTGCAAAAAGATTCATGAAATTCCXGTCATTTCTCTACA
ATACAATTTACAGTTCGAATAA\(3')GATTCCAGTTGGCTTTATTCCAATTCTGTTAAATACTGTGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan