ESTScan Details for Unigene SGN-U298161

Score 
270
Direction 
Forward
Predicted Peptide Sequence 
VWRLEFDFLIYYHPLMDLKKLSIENLAKRILEFESFSEVKEEEKNRFFIGYQVLKLIEEMDDEVNSWIRRTKFSHTVCHRLDSARRLTSI
PISTIQPGRIAGAKTRPGRGSFISRPEPTVAPLQRNPTTNKHRTVSPHPETSVPDTFKEARSSPEEIFKSAFTKRRNMRKKIVSKSFYKD
SRESKSPMLRS
Predicted Coding Sequence 
XXGGTATGGAGGTTGGAGTTTGATTTCTTGATCTACTACCATCCTTTGATGGACTTGAAGAAATTGTCAATAGAAAACTTGGCAAAGAGA
ATTCTTGAATTTGAATCTTTTTCTGAGGTGAAGGAGGAGGAAAAGAACAGATTTTTTATTGGTTATCAGGTGTTGAAGCTGATTGAAGAA
ATGGATGATGAAGTTAATTCTTGGATTAGGAGAACAAAGTTTTCTCATACAGTTTGTCATAGGTTGGATTCTGCTAGACGXTTGACTTCT
ATTCCTATTAGTACTATTCAGCCAGGAAGAATTGCTGGTGCAAAAACTAGACCTGGAAGAGGTTCTTTTATTTCAAGACCTGAGCCAACT
GTTGCGCCACTTCAGCGCAATCCAACTACAAACAAACATAGGACTGTATCACCTCATCCAGAAACATCAGTTCCAGATACCTTTAAGGAA
GCTCGATCTAGTCCAGAAGAGATTTTCAAATCCGCGTTCACAAAGCGAAGGAACATGAGGAAGAAGATCGTGAGTAAGTCATTTTATAAA
GATTCCCGGGAATCGAAATCACCTATGTTGAGATCT\
Edits in Original Sequence 
(5')XXGGTATGGAGGTTGGAGTTTGATTTCTTGATCTACTACCATCCTTTGATGGACTTGAAGAAATTGTCAATAGAAAACTTGGCAAA
GAGAATTCTTGAATTTGAATCTTTTTCTGAGGTGAAGGAGGAGGAAAAGAACAGATTTTTTATTGGTTATCAGGTGTTGtAAGCTGATTG
AAGAAATGGATGATGAAGTTAATTCTTGGATTAGGAGAACAAAGTTTTCTCATACAGTTTGTCATAGGTTGGATTCTGCTAGACGXTTGA
CTTCTATTCCTATTAGTACTATTCAGCCAGGAAGAATTGCTGGTGCAAAAACTAGACCTGGAAGAGGTTCTTTTATTTCAcAGACCTGAG
CCAACTGTTGCGCCACTTCAGCGCAATCCAACTACAAACAAACATAGGACTGTATCACCTCATCCAGAAACATCAGTTCCAGATACCTTT
AAGGAAGCTCGATCTAGTCCAGAAGAGATTTTCAAATCCGCGTTCACAAAGCGAAGGAACATGAGGAAGAAGATCGTGAGTAAGTCATTT
TATAAAGATTCCCGGGAATCGAAATCACCTATGTTGAGATCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan