ESTScan Details for Unigene SGN-U298278

Score 
409
Direction 
Forward
Predicted Peptide Sequence 
GRARQFGAINKLLEQMVKDGCQPNVVTYNRLIHSYGRANYLREALHVFSQMQEARVEPDRVTYCTLIDIHAKAGYLDVAMDLYERMQDAG
LSPDTFTYSVIINCLGKAGHLAAAAQTVLEMVNQGCVPNLVTYNIMIALHAKARNYSSALQLYRDMQNAGFEPDKVTYSIVMEVLGHCGY
LEEAEAVFTEMKRKNWVPDEPVYGLLVDLWGKGWECRKG
Predicted Coding Sequence 
GGACGTGCTAGGCAGTTTGGGGCAATTAACAAGTTGCTTGAGCAGATGGTCAAAGATGGGTGCCAACCAAATGTAGTGACATATAACCGT
CTCATTCACAGTTACGGCAGAGCAAACTACTTGCGTGAAGCATTACATGTCTTTAGTCAAATGCAGGAAGCTAGAGTTGAACCTGACCGT
GTAACCTATTGTACTCTAATTGACATCCATGCAAAAGCTGGTTACCTTGATGTTGCCATGGACTTGTATGAAAGGATGCAAGATGCTGGG
CTCTCTCCAGACACTTTCACTTACAGTGTCATTATTAATTGCCTTGGAAAAGCAGGCCACTTAGCTGCTGCXGCACAAACTGTTCTTGAG
ATGGTTAATCAGGGCTGTGTACCAAACTTGGTAACCTACAACATTATGATTGCATTGCATGCAAAAGCAAGGAACTATTCTAGTGCATTA
CAATTATATCGAGACATGCAGAATGCTGGATTTGAGCCAGACAAGGTGACATACAGTATTGTGATGGAGGTGCTTGGCCATTGTGGCTAT
CTGGAGGAAGCTGAGGCAGTTTTTACAGAGATGAAAAGGAAGAATTGGGTACCTGATGAACCTGTATATGGTCTTCTAGTGGACTTATGG
GGAAAAGGCTGGGAATGTAGAAAAGGX\
Edits in Original Sequence 
(5')GGACGTGCTAGGCAGTTTGGGGCAATTAACAAGTTGCTTGAGCAGATGGTCAAAGATGGGTGCCAACCAAATGTAGTGACATATAA
CCGTCTCATTCACAGTTACGGCAGAGCAAACTACTTGCGTGAAGCATTACATGTCTTTAGTCAAATGCAGGAAGCTAGAGTTGAACCTGA
CCGTGTAACCTATTGTACTCTAATTGACATCCATGCAAAAGCTGGTTACCTTGATGTTGCCATGGACTTGTATGAAAGGATGCAAGATGC
TGGGCTCTCTCCAGACACTTTCACTTACAGTGTCATTATTAATTGCCTTGGAAAAGCAGGCCACTTAGCTGCTGCXGCACAAACTGTTCT
gTGAGATGGTTAATCAGGGCTGTGTACCAAACTTGGTAACCTACAACATTATGATTGCATTGCATGCAAAAGCAAGGAACTATTCTAGTG
CATTACAATTATATCGAGACATGCAGAATGCTGGATTTGAGCCAGACAAGGTGACATACAGTATTGTGATGGAGGTGCTTGGCCATTGTG
GCTATCTGGAGGAAGCTGAGGCAGTTTTTACAGAGATGAAAAGGAAGAATTGGGTACCTGATGAACCTGTATATGGTCTTCTAGTGGACT
TATGGGGAAAAGGCTGGGAATGTAGAAAAGGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan