ESTScan Details for Unigene SGN-U298407

Score 
346
Direction 
Forward
Predicted Peptide Sequence 
TVHGGEKGPSHXLQQQNKVQIFNMGQGLSCGTSDEHGLFTAVQCGDLETVKALFERNPSLVHHSTVYDRQSALHIAAANGQIEVVSMLLD
KSVKPDLLNRYKQTPLMLAAMHGKISCVQKLIEAGAKYFDVDSLNGRTCLHYGPIMGTSECLKTILFAARTSHIASSRGYAPVCERYSMV
KGATPFALSSSS
Predicted Coding Sequence 
XCCACCGTCCACGGTGGTGAAAAGGGGCCTTCTCATCAXCTGCAGCAGCAGAATAAAGTTCAGATTTTTAATATGGGTCAGGGGCTCAGT
TGTGGAACAAGTGATGAACATGGATTGTTTACTGCTGTTCAGTGTGGTGATTTGGAGACTGTGAAGGCTCTGTTTGAGAGAAACCCAAGT
CTTGTTCATCATTCTACAGTTTATGATCGACAGTCTGCTTTACATATTGCTGCTGCCAATGGCCAAATTGAGGTTGTTTCTATGCTTTTA
GACAAGTCTGTCAAGCCTGATTTATTGAATCGATATAAACAGACTCCATTGATGCTAGCCGCAATGCACGGGAAGATCTCTTGTGTGCAA
AAGCTTATTGAAGCTGGGGCCAAATATTTTGATGTTGATTCGTTGAATGGGAGAACATGCTTGCACTATGGGCCTATTATGGGCACTTCT
GAATGTCTCAAAACAATTCTTTTTGCTGCTCGGACATCACACATTGCGTCTTCTAGGGGATATGCXCCGGTTTGTGAACGTTACTCGATG
GTAAAGGGAGCAACACCCTTTGCACTTAGCAGCTCGTCX\
Edits in Original Sequence 
(5')XCCACCGTCCACGGTGGTGAAAAGGGGCCTTCTCATCAXCTGCAGCAGCAGAATAAAGTTCAGATTTTTAATATGGGTCAGGGGCT
CAGTTGTGGAACAAGTGATGAACATGGATTGTTTACTGCTGTTCAGTGTGGTGATTTGGAGACTGTGAAGGCTCTGTTTGAGAGAAACCC
AAGTCTTGTTCATCATTCTACAGTTTATGATCGACAGTCTGCTTTACATATTGCTGCTGCCAATGGCCAAATTGAGGTTGTTTCTATGCT
TTTAGACAAGTCTGTCAAGCCTGATTTATTGAATCGATATAAACAGACTCCATTGATGCTAGCCGCAATGCACGGGAAGATCTCTTGTGT
GCAAAAGCTTATTGAAGCTGGGGCCAAATATTTTGATGtTTGATTCGTTGAATGGGAGAACATGCTTGCACTATGcGGCCTATTATGGGC
ACTTCTGAATGTCTCAAAACAATTCTTTTTGCTGCTCGGACATCACACATTGCGTCTTCTAGGGGATATGCXCCGGTTTGTGAACGTTAC
TCGATGGTAAAGGGAGCAACACCCTTTGCACTTAGCAGCTCGTCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan