ESTScan Details for Unigene SGN-U299013

Score 
159
Direction 
Forward
Predicted Peptide Sequence 
NKDLFTGMCVLAGCDXFFLSVPGIGITRAYNLVSKYRNLDRVLSTLSFEKGDQMPEDYARSFREAVAVFHHARIYDVSLKAGSKHLKAIP
EXAVASFLDEELDFLDPEILPSLATSI
Predicted Coding Sequence 
AACAAAGATTTATTTACAGGCATGTGTGTCTTAGCTGGCTGTGATXTTTTCTTCCTTTCAGTCCCTGGTATAGGAATTACAAGAGCTTAT
AATCTGGTCTCCAAATATCGCAATTTAGATCGAGTTCTTTCCACGTTAAGTTTTGAGAAAGGAGATCAAATGCCCGAAGATTATGCAAGA
TCATTTAGAGAAGCAGTTGCAGTTTTCCATCATGCTAGAATATATGATGTTAGTTTGAAAGCXGGATCAAAGCACTTGAAAGCCATCCCA
GAAGAXGCTGTTGCAAGTTTTTTGGACGAAGAACTTGACTTCTTAGACCCAGAAATTCTTCCGTCATTGGCAACATCAATT\
Edits in Original Sequence 
(5')AACAAAGATTTATTTACAGGCATGTGTGTCTTAGCTGGCTGTGATXTTTTCTTCCTTTCAGTCCCTGGTATAGGAATTACAAGAGC
TTATAATCTGGTCTCCAAATATCGCAATTTAGATCGAGTTCTTTCCACGTTaAAGTTTTGAGAAAGGAGATCAAATGCCCGAAGATTATG
CAAGATCATTTAGAGAAGCAGTTGCAGTTTTCCATCATGCTAGAATATATGATGTTAGTTTGAAAGCXGGATCAAAGCACTTGAAAGCCA
TCCCAGAAGAXGCTGTTGCAAGTTTTTTGGACGAAGAACTTGACTTCTTAGACCCAGAAATTCTTCCGTCATTGGCAACATCAATT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan