ESTScan Details for Unigene SGN-U299114

Score 
362
Direction 
Forward
Predicted Peptide Sequence 
GMAILKARSLQVTLKVWCRYGTSQEXQVFMEMREHERRVWSVDFSVADPTMLAAGVMMVLSNSGISIRQFYFCTWWMSALKLNGASVGTI
KTKANAAAVQFPFDSGRSLAFGSADHKIYYYDLRNSKMPLCTLIGHNKTVSYVKFIDSTTLVSASTDNTLKLWDLSICTSRIVDKPLQSF
TGHMNVKNFVGLSVSEGYIATGSETNEVFVYHKAFPMPALSFKFNSTDPLSGDEVDDQAQFISSVCWRGQASX
Predicted Coding Sequence 
XTTGGAATGGCTATATTAAAAGCCAGATCGCTTCAAGTAACTTTGAAGGTGTGGTGCAGGTATGGGACGTCACAAGAAGXTCAGGTTTTC
ATGGAAATGAGAGAACATGAAAGGCGTGTCTGGTCTGTTGACTTTTCTGTAGCAGATCCAACCATGTTGGCTGCGGGAGTGATGATGGTT
CTGTCAAACTCTGGAATATCAATCAGGCAATTCTATTTCTGCACTTGGTGGATGTCAGCTTTGAAACTAAACGGAGCAAGTGTTGGAACC
ATCAAAACAAAAGCCAATGCTGCTGCXGTTCAGTTCCCCTTTGATTCTGGTCGCTCCCTTGCTTTTGGTTCAGCAGATCACAAGATATAT
TACTATGATCTACGTAACTCAAAAATGCCTCTATGCACATTAATCGGGCACAACAAGACTGTGAGCTATGTCAAGTTCATAGATTCCACA
ACGCTTGTGTCTGCATCTACAGATAACACGTTAAAGCTATGGGATTTGTCAATTTGCACATCCCGGATTGTTGATAAACCTCTTCAGTCA
TTTACTGGACACATGAATGTAAAGAACTTTGTTGGCTTATCTGTATCTGAAGGTTACATTGCTACTGGCTCAGAGACAAATGAGGTCTTT
GTGTATCACAAAGCTTTTCCTATGCCTGCATTATCATTTAAATTTAATAGCACAGATCCACTATCTGGTGATGAAGTGGATGACCAAGCA
CAGTTTATCTCATCTGTTTGTTGGCGTGGTCAGGCCTCTAXX\
Edits in Original Sequence 
(5')XTTGGAATGGCTATATTAAAAGCCAGATCGCTTCAAGTAACTTTGAAGGTGTGGTGCAGGTATGGGACGTCACAAGAAGXTCAGGT
TTTCATGGAAATGAGAGAACATGAAAGGCGTGTCTGGTCTGTTGACTTTTCTGTAGCAGATCCAACCATGTTGGCTaGCGGGAGTGATGA
TGGTTCTGTCAAACTCTGGAATATCAATCAGGCAATTCTATTTCTGCACTTGGTGGATGTCAGCTTTGAAACTAAACGGAGCAAGTGTTG
GAACCATCAAAACAAAAGCCAATGtCTGCTGCXGTTCAGTTCCCCTTTGATTCTGGTCGCTCCCTTGCTTTTGGTTCAGCAGATCACAAG
ATATATTACTATGATCTACGTAACTCAAAAATGCCTCTATGCACATTAATCGGGCACAACAAGACTGTGAGCTATGTCAAGTTCATAGAT
TCCACAACGCTTGTGTCTGCATCTACAGATAACACGTTAAAGCTATGGGATTTGTCAATTTGCACATCCCGGATTGTTGATAAACCTCTT
CAGTCATTTACTGGACACATGAATGTAAAGAACTTTGTTGGCTTATCTGTATCTGAAGGTTACATTGCTACTGGCTCAGAGACAAATGAG
GTCTTTGTGTATCACAAAGCTTTTCCTATGCCTGCATTATCATTTAAATTTAATAGCACAGATCCACTATCTGGTGATGAAGTGGATGAC
CAAGCACAGTTTATCTCATCTGTTTGTTGGCGTGGTCAGGCCTCTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan