ESTScan Details for Unigene SGN-U299278

Score 
1131
Direction 
Forward
Predicted Peptide Sequence 
IPRAAESKKRSRSSWLAXAANFTPSASSQVNTRPSIPLGFPSVSSSWTFSVSRSKNKMFGRAPKRSDNTKYYEVLGVSKNASQDDLKKAY
RKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGVHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGEDVIH
PLKVSLEDLYNGTSKKLSLSRNVLCPKCKGKGSKSGASMKCWAVRGXGMKVSIRQLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGE
KVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKHDDLFYEHTLSLTEALCGFQFILTHLDGRQLLIKS
QPGEVVKPDQFKAINDEGMVVYQRPFMRGKLYIHFNVEFPDYLDPEQCKSLEAVLPPKTTKQITDMELDECEETTLHDVNIEDEMRRKQQ
GQEAYEEDEDMHGGAQRVQCAPAVSWEESGRXKEPNPGDEREISILLKL
Predicted Coding Sequence 
XXGATCCCCCGGGCTGCGGAATCAAAAAAACGCTCTCGATCGTCGTGGCTCGCTAXGGCCGCTAATTTTACTCCGTCCGCCAGCTCCCAA
GTCAACACTCGACCGTCAATCCCTCTAGGGTTTCCGTCCGTATCCTCCTCCTGGACATTTTCCGTGAGTAGATCGAAGAACAAGATGTTT
GGGAGGGCGCCGAAAAGGAGCGATAACACAAAGTACTATGAGGTATTGGGGGTTTCCAAGAACGCCTCCCAAGATGATCTCAAGAAGGCT
TATCGTAAAGCTGCCATCAAGAATCACCCTGATAAGGGAGGAGATCCGGAAAAGTTTAAAGAGCTAGCTCAAGCCTACGAGGTACTTAGT
GACCCAGAGAAGCGTGAGATCTATGATCAGTATGGTGAGGATGCATTGAAGGAAGGAATGGGTGGTGGAGGTGGTGTCCATGATCCATTT
GACATCTTCCAGTCATTCTTTGGTGGTAGCCCTTTTGGTGGAGGTGGAAGCAGCAGAGGCAGAAGGCAAAGAAGGGGAGAGGATGTCATT
CATCCTCTTAAAGTTTCTTTGGAGGACCTGTACAATGGAACCTCTAAGAAGTTGTCCCTCTCACGAAACGTGTTGTGCCCAAAGTGCAAG
GGCAAAGGTTCTAAATCAGGTGCTTCAATGAAATGTTGGGCTGTCAGGGGTXCTGGGATGAAAGTTTCTATTAGACAGCTTGGTCCGTCG
ATGATACAGCAGATGCAGCATCCTTGTAATGAGTGTAAAGGTACTGGTGAAACTATTAACGACAAGGATCGCTGCCCACAGTGCAAGGGT
GAGAAGGTTGTGCAGGAAAAGAAGGTTTTGGAAGTTGTCGTAGAGAAGGGTATGCAAAATGGGCAAAAAATTACATTCCCTGGTGAAGCT
GATGAAGCACCGGACACAGTTACTGGGGATATTGTCTTTGTCCTGCAACAGAAAGAGCATCCAAAATTCAAGCGCAAGCATGATGACCTG
TTCTATGAGCACACTCTCTCCCTGACTGAGGCTCTTTGCGGCTTCCAATTTATTTTGACTCACCTGGATGGCAGGCAACTTCTTATTAAA
TCCCAGCCCGGAGAAGTGGTCAAGCCTGATCAATTCAAGGCAATAAATGATGAGGGGATGGTGGTGTACCAGAGGCCATTTATGAGAGGT
AAATTGTATATTCACTTTAATGTGGAATTCCCGGACTATCTGGACCCTGAGCAGTGCAAGTCTCTGGAGGCTGTGTTGCCACCAAAGACC
ACAAAACAAATTACTGACATGGAGTTGGATGAGTGTGAGGAGACCACACTACATGACGTAAACATTGAGGATGAGATGCGTAGGAAACAA
CAAGGGCAAGAAGCATATGAGGAAGATGAAGATATGCATGGTGGTGCTCAGAGAGTGCAGTGTGCXCCAGCAGTGAGTTGGGAGGAAAGT
GGTAGAAAXAAGGAGCCAAATCCAGGAGATGAGCGAGAAATCAGTATTTTATTAAAGCTTTAA
Edits in Original Sequence 
(5')XXGATCCCCCGGGCTGCGGAATCAAAAAAACGCTCTCGATCGTCGTGGCTCGCTAXGGCCGCTAATTTTACTCCGTCCGCCAGCTC
CCAAGTCAACACTCGACCGTCAATCCCTCTAGGGTTTCCGTCCGTATCCTCCTCCTGGACATTTTCCGTGAGTAGATCGAAGAACAAGAT
GTTTGGGAGGGCGCCGAAAAGGAGCGATAACACAAAGTACTATGAGGTATTGGGGGTTTCCAAGAACGCCTCCCAAGATGATCTCAAGAA
GGCTTATCGTAAAGCTGCCATCAAGAATCACCCTGATAAGGGAGGAGATCCGGAAAAGTTTAAAGAGCTAGCTCAAGCCTACGAGGTACT
TAGTGACCCAGAGAAGCGTGAGATCTATGATCAGTATGGTGAGGATGCATTGAAGGAAGGAATGGGTGGTGGAGGTGGTGTCCATGATCC
ATTTGACATCTTCCAGTCATTCTTTGGTGGTAGCCCTTTTGGTGGAGGTGGAAGCAGCAGAGGCAGAAGGCAAAGAAGGGGAGAGGATGT
CATTCATCCTCTTAAAGTTTCTTTGGAGGACCTGTACAATGGAACCTCTAAGAAGTTGTCCCTCTCACGAAACGTGTTGTGCCCAAAGTG
CAAGGGCAAAGGTTCTAAATCAGGTGCTTCAATGAAATGTTcGGGCTGTCAGGGGTXCTGGGATGAAAGTTTCTATTAGACAGCTTGGTC
CGTCGATGATACAGCAGATGCAGCATCCTTGTAATGAGTGTAAAGGTACTGGTGAAACTATTAACGACAAGGATCGCTGCCCACAGTGCA
AGGGTGAGAAGGTTGTGCAGGAAAAGAAGGTTTTGGAAGTTGTCGTAGAGAAGGGTATGCAAAATGGGCAAAAAATTACATTCCCTGGTG
AAGCTGATGAAGCACCGGACACAGTTACTGGGGATATTGTCTTTGTCCTGCAACAGAAAGAGCATCCAAAATTCAAGCGCAAGCATGATG
ACCTGTTCTATGAGCACACTCTCTCCCTGACTGAGGCTCTTTGCGGCTTCCAATTTATTTTGACTCACCTGGATGGCAGGCAACTTCTTA
TTAAATCCCAGCCCGGAGAAGTGGTCAAGCCTGATCAATTCAAGGCAATAAATGATGAGGGGATGGTGGTGTACCAGAGGCCATTTATGA
GAGGTAAATTGTATATTCACTTTAATGTGGAATTCCCGGACTATCTGGACCCTGAGCAGTGCAAGTCTCTGGAGGCTGTGTTGCCACCAA
AGACCACAAAACAAATTACTGACATGGAGTTGGATGAGTGTGAGGAGACCACACTACATGACGTAAACATTGAGGATGAGATGCGTAGGA
AACAACAAGGGCAAGAAGCATATGAGGAAGATGAAGATATGCATGGTGGTGCTCAGAGAGTGCAGTGTGCXCCAGCAGTGAGTTGGGAGG
AAAGTGGTAGAAAXAAGGAGCCAAATCCAGGAGATGAGCGAGAAATCAGTATTTTATTAAAGCTTTAA(3')TAGGTTTGTTGAGGCAAT
GACATTTTGTACAATGTTTGTCCTCAATTTTATTAGAATTAGATTTGCTAGTTAACTATTTGTAACTTTTGCATTTCTTTGCAAACTGAT
ACTGTATCCAATGTTCACAGTGGACCATTGTGATTCAAAACGCGAGTTTGATATGCGGTTTAGAAGAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan