ESTScan Details for Unigene SGN-U299348

Score 
719
Direction 
Forward
Predicted Peptide Sequence 
TNIPPIIVVAEKERQQKWHPWFQAGLPNLQTLPANYVVPVDQRPGKLAPISMDIPVIDLGDADRGAVVQKIIKASQEFGLFQVINHGVPE
KLMIDAKSVGQEFFSIAAEGKEMLIADDNNMDGNFTPVLENTAPKILRSGKTLCSIHAILLRVAVKSWPDKPARYREVIGPYTVEVRELG
KRVLELIYEGLGFTEKNFDSYDLVLMIHNYPACPDPGSALGSGGHYDGNIITLLQQDVYGLQLFKDGQWHGVEPLPNAFVINISFALEVI
SNGKLKSALHRVVTNSDCSRTSFASFINVPFNRIIEPAKSVVSPSNPPVFRGFLFEEFMKVLISKNSDMDATFDYFKIKSQAAXIMLSLD
NILPLLGMANYLKLDFRRNLSACASCLPYNAFWISLA
Predicted Coding Sequence 
XCAACAAACATACCTCCCATAATTGTTGTTGCAGAGAAGGAGCGACAACAAAAATGGCATCCCTGGTTTCAAGCTGGTCTTCCXAATCTG
CAAACTCTGCCAGCAAATTATGTTGTGCCTGTGGACCAAAGGCCAGGAAAGCTTGCTCCAATAAGCATGGACATACCAGTGATTGATCTT
GGCGATGCAGATCGAGGTGCAGTGGTTCAGAAAATCATAAAAGCTAGTCAAGAATTTGGATTATTCCAGGTGATCAACCATGGAGTGCCA
GAAAAGTTGATGATTGATGCAAAGAGTGTGGGGCAAGAATTCTTTTCAATAGCTGCTGAGGGTAAAGAGATGTTGATTGCTGATGATAAC
AACATGGATGGGAACTTTACACCAGTTCTGGAAAATACAGCACCCAAGATTTTGCGTTCTGGAAAGACACTTTGCAGCATCCATGCCATC
CTCTTGAGAGTTGCXGTCAAATCTTGGCCCGATAAGCCAGCAAGATACCGAGAGGTTATAGGACCATATACGGTTGAAGTGAGAGAACTA
GGCAAGAGAGTTTTGGAACTGATCTATGAAGGATTAGGATTTACTGAGAAAAACTTCGATAGTTATGACTTGGTCCTGATGATCCATAAT
TATCCAGCATGCCCTGATCCTGGTTCTGCTTTGGGATCGGGTGGACACTATGATGGAAACATCATAACTTTACTTCAGCAAGATGTTTAT
GGGCTACAACTATTTAAGGATGGCCAGTGGCATGGGGTTGAGCCTCTTCCCAATGCATTCGTGATAAACATATCTTTTGCCCTTGAGGTA
ATCAGCAACGGGAAGCTAAAAAGTGCTCTGCACCGAGTTGTTACAAATTCAGATTGTTCTAGGACATCATTTGCCAGCTTTATTAATGTT
CCTTTCAATAGGATCATTGAACCTGCAAAGTCAGTTGTTAGTCCAAGCAATCCACCAGTATTCAGAGGGTTCCTATTCGAAGAGTTTATG
AAGGTTCTTATAAGCAAGAATTCTGACATGGATGCCACGTTTGACTATTTCAAAATCAAGAGCCAAGCTGCCGAXATAATGTTGTCTTTG
GATAATATCCTTCCGCTTCTTGGAATGGCAAACTACCTGAAGCTTGATTTCCGCAGAAATTTATCTGCTTGTGCAAGTTGTCTACCATAC
AATGCATTTTGGATCTCGTTAGCATAA
Edits in Original Sequence 
(5')XCAACAAACATACCTCCCATAATTGTTGTTGCAGAGAAGcGAGCGACAACAAAAATGGCATCCCTGGTTTCAAGCTGGTCTTCCXA
ATCTGCAAACTCTGCCAGCAAATTATGTTGTGCCTGTGGACCAAAGGCCAGGAAAGCTTGCTCCAATAAGCATGGACATACCAGTGATTG
ATCTTGGCGATGCAGATCGAGGTGCAGTGGTTCAGAAAATCATAAAAGCTAGTCAAGAATTTGGATTATTCCAGGTGATCAACCATGGAG
TGCCAGAAAAGTTGATGATTGATGCAAAGAGTGTGGGGCAAGAATTCTTTTCAATAGCTGCTGAGGGTAAAGAGATGTTGATTGCTGATG
ATAcACAACATGGATGGGAACTTTACACCAGTTCTGGAAAATACAGCACCCAAGATTTTGCGTTCTGGAAAGACACTTTGCAGCATCCAT
GCCATCCTCTTGAGAGTTGCXGTCAAATCTTGGCCCGATAAGCCAGCAAGATACCGAGAGGTTATAGGACCATATACGGTTGAAGTGAGA
GAACTAGGCAAGAGAGTTTTGGAACTGATCTATGAAGGATTAGGATTTACTGAGAAAAACTTCGATAGTTATGACTTGGTCCTGATGATC
CATAATTATCCAGCATGCCCTGATCCTGGTTCTGCTTTGGGATCGGGTGGACACTATGATGGAAACATCATAACTTTACTTCAGCAAGAT
GTTTATGGGCTACAACTATTTAAGGATGGCCAGTGGCATGGGGTTGAGCCTCTTCCCAATGCATTCGTGATAAACATATCTTTTGCCCTT
GAGGTAATCAGCAACGGGAAGCTAAAAAGTGCTCTGCACCGAGTTGTTACAAATTCAGATTGTTCTAGGACATCATTTGCCAGCTTTATT
AATGTTCCTTTCAATAGGATCATTGAACCTGCAAAGTCAGTTGTTAGTCCAAGCAATCCACCAGTATTCAGAGGGTTCCTATTCGAAGAG
TTTATGAAGGTTCTTATAAGCAAGAATTCTGACATGGATGCCACGTTTGACTATTTCAAAATCAAGAGCCAAGCTGCCGAXATAATGTTG
TCTTTGGATAATATCCTTCCGCTTCTTGGAATGGCAAACTACCTGAAGCTaTGATTTCCGCAGAAATTTATCTGCTTGTGCAAGTTGTCT
ACCATACAATGCATTTTGGATCTCGTTAGCATAA(3')TATTTTGTGAATTATAAAACTATGAATTTGTGAGAAAAAAATTGTTTGACTA
GCTCGGATCGAATGCATCCCTAAATCAGTAACCAAAACGGACTTGGACTAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan