ESTScan Details for Unigene SGN-U299352

Score 
957
Direction 
Forward
Predicted Peptide Sequence 
MESGMINLGSSLKVSYVQELAKEKFASVPPRYIRPDPTKLDGASTEEIPVIDMQRLLSDESVNPELEKLHFACKEWGFFQVINHGVSSSL
VDKLKLEMQKFFNLTIEEKKRFAQEPGDVEGYGQAFVVSEEQKLNWGDMLFMVALPTHLRKPHLLPNLPLPFRETLDQYSRELKILAIKV
LEQMTKALGMKLEDMTMLFEDGMQTMRMNYYPPCPQPELVMGLCPHSDADGLTILLQVNEVEGLQIKKAGAWVPVVPLPNAFTVNVGDIL
EIVTNGIYKSVEHRATVNLHNERLSIAAFFFPKVDGDMGPAPSLTPPENPAIFRRISTIDYLKAFFSRELDGKSFIDAMRTQSEDF
Predicted Coding Sequence 
ATGGAATCTGGTATGATAAATTTGGGAAGCTCTCTAAAAGTATCCTATGTTCAGGAGTTGGCTAAGGAGAAATTTGCATCAGTTCCACCC
CGATACATACGACCTGATCCAACCAAACTTGATGGGGCCTCCACAGAGGAAATCCCAGTAATTGACATGCAAAGGTTGCTTTCGGATGAA
TCAGTGAATCCAGAGCTTGAAAAGTTGCATTTTGCCTGCAAAGAATGGGGCTTCTTCCAGGTGATTAATCATGGAGTGAGCTCTTCATTA
GTGGACAAACTGAAACTAGAGATGCAAAAGTTTTTCAATTTGACGATTGAAGAGAAGAAGAGATTTGCCCAAGAACCGGGCGATGTAGAA
GGATATGGACAGGCCTTTGTTGTATCGGAGGAACAAAAACTTAACTGGGGTGACATGCTATTCATGGTCGCTCTGCCAACTCACTTGAGA
AAACCTCATTTACTTCCCAACCTTCCTCTTCCATTCAGAGAAACTCTAGATCAGTACTCAAGGGAATTGAAAATCCTTGCCATCAAGGTC
CTTGAGCAAATGACAAAAGCATTAGGAATGAAGCTTGAAGATATGACAATGCTTTTTGAAGATGGGATGCAAACAATGAGGATGAACTAT
TATCCTCCATGTCCCCAACCTGAGCTAGTGATGGGCCTTTGCCCCCACTCTGATGCTGATGGGCTTACCATATTACTTCAAGTCAACGAA
GTGGAAGGCCTCCAAATCAAAAAGGCTGGAGCTTGGGTTCCTGTTGTACCACTTCCTAATGCATTCACAGTCAATGTTGGAGACATTTTA
GAGATTGTGACAAATGGGATTTACAAGAGTGTTGAGCATCGGGCAACTGTGAATTTGCACAATGAAAGGCTTTCCATTGCAGCGTTCTTT
TTCCCAAAAGTGGATGGTGACATGGGTCCAGCGCCAAGTCTTACCCCCCCTGAAAATCCAGCAATTTTCAGAAGAATTAGTACGATTGAC
TATTTAAAAGCGTTTTTTTCCCGTGAACTAGATGGGAAATCATTCATTGACGCAATGAGGACCCAAAGCGAAGACTTTTAG
Edits in Original Sequence 
CGGGCTGCAGGATTCGGCACGAGGGTGTATATATATATATATATGTATATAGGTAGAGATTTACAGAAACCACAAAC(5')ATGGAATCT
GGTATGATAAATTTGGGAAGCTCTCTAAAAGTATCCTATGTTCAGGAGTTGGCTAAGGAGAAATTTGCATCAGTTCCACCCCGATACATA
CGACCTGATCCAACCAAACTTGATGGGGCCTCCACAGAGGAAATCCCAGTAATTGACATGCAAAGGTTGCTTTCGGATGAATCAGTGAAT
CCAGAGCTTGAAAAGTTGCATTTTGCCTGCAAAGAATGGGGCTTCTTCCAGGTGATTAATCATGGAGTGAGCTCTTCATTAGTGGACAAA
CTGAAACTAGAGATGCAAAAGTTTTTCAATTTGACGATTGAAGAGAAGAAGAGATTTGCCCAAGAACCGGGCGATGTAGAAGGATATGGA
CAGGCCTTTGTTGTATCGGAGGAACAAAAACTTAACTGGGGTGACATGCTATTCATGGTCGCTCTGCCAACTCACTTGAGAAAACCTCAT
TTACTTCCCAACCTTCCTCTTCCATTCAGAGAAACTCTAGATCAGTACTCAAGGGAATTGAAAATCCTTGCCATCAAGGTCCTTGAGCAA
ATGACAAAAGCATTAGGAATGAAGCTTGAAGATATGACAATGCTTTTTGAAGATGGGATGCAAACAATGAGGATGAACTATTATCCTCCA
TGTCCCCAACCTGAGCTAGTGATGGGCCTTTGCCCCCACTCTGATGCTGATGGGCTTACCATATTACTTCAAGTCAACGAAGTGGAAGGC
CTCCAAATCAAAAAGGCTGGAGCTTGGGTTCCTGTTGTACCACTTCCTAATGCATTCACAGTCAATGTTGGAGACATTTTAGAGATTGTG
ACAAATGGGATTTACAAGAGTGTTGAGCATCGGGCAACTGTGAATTTGCACAATGAAAGGCTTTCCATTGCAGCGTTCTTTTTCCCAAAA
GTGGATGGTGACATGGGTCCAGCGCCAAGTCTTACCCCCCCTGAAAATCCAGCAATTTTCAGAAGAATTAGTACGATTGACTATTTAAAA
GCGTTTTTTTCCCGTGAACTAGATGGGAAATCATTCATTGACGCAATGAGGACCCAAAGCGAAGACTTTTAG(3')GGTCTTAGTCCCTC
TATGCTTTTTCTCTTTGAAACTTATGTACACTGTTGATATGGTGTCCCCTCTTCATCGCCTCCCCCAACTTTCATTCATCACAATATGTA
TAATTGTTTAAGAATTAATCCTTTATAAACTGTGTATGCTATTAGATTCGAATGCATAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan