Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U299475

Score 
155
Direction 
Forward
Predicted Peptide Sequence 
MALARFEKKIFDLMALWPEEMPPQNESRKDPXILVHYPTLIELIGKSHHHTYNYNMRPMMVRQLNEGISAKSNDGLVALWYYSKAVPPVV
E
Predicted Coding Sequence 
ATGGCACTTGCCCGGTTTGAAAAAAAAATATTTGATTTGATGGCACTTTGGCCGGAGGAAATGCCACCCCAAAATGAAAGCAGGAAGGAC
CCCGXTATTTTAGTGCATTACCCAACTTTGATTGAATTAATTGGTAAATCTCATCATCATACGTACAATTACAACATGCGTCCAATGATG
GTCAGGCAATTGAATGAAGGAATTAGTGCAAAATCCAATGATGGGTTAGTAGCATTATGGTACTACTCAAAGGCTGTACCACCAGTAGTA
GAGTAG
Edits in Original Sequence 
GCAGGAATTCGGTATCAGGGGGATTATCACGTGAAGCTATCAATGATCTACCTACATGTAACCTTCATTCTATAGAGACCACAAATCCTT
CTTGCCATGAAACAATCTGTGCAATTTGCTTGACGGTAATCTATTTTCCTCAGTCCGGACAGGAACAAGAAAATGTTCTCTTTCTTGGCA
CCTATTATTTTCCTCCTATATTTAATGGAGTATCTTGATGATCACTGATCAGTCTGTGTGTGTGTGTTTTTTTTTTTTTTTTTGCTTATT
ATTATTATTATTACCTTGAAATAAATAAACAGGACTTCAAAAACGGAGATTGGGCACGGATGCTTCCTACTTGGGGACATTCTTTCCACT
TAAATTGCATAAATGAATGGTTAAACAGGA
(5')ATGGCACTTGCCCGGTTTGAAAAAAAAATATTTGATTTGATGGCACTTTGGCCGGA
GGAAATGCaCACCCCAAAATGAAAGCAGGAAGGACCCCGXTATTTTAGTGCATTACCCAACTTTGATTGAATTAATTaGGTAAATCTCAT
CATCATACGTACAATTACAACATGCGTCCAATGATGGTCAGGCAATTGAATGtAAGGAATTAGTGCAAAATCCAATGATGGGTTAGTAGC
ATTATGGTACTACTCAAAGGCTGTACCACCAGTAGTAGAGTAG(3')TGTGTTTGTTATTTTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan