ESTScan Details for Unigene SGN-U299477

Score 
64
Direction 
Forward
Predicted Peptide Sequence 
ESNLREISDIFEVNSIRGLSREAINDLPTCNLHSIETTNPSCHETICAICLTDFKNGDCARMLPTCGHSFHLNCIDEWLTGMALARFVKE
IFDXDGTLAGGDAEHKMRAGRNPYFSALANFDELIGKSHHHTYNYNMRPXDGQAIECKELVQNPMMGSSIMVLLKGCTTSSRVECLLVWD
EAPGRLSKTIVRGSSRPG
Predicted Coding Sequence 
XXGGAATCAAATTTGAGGGAGATTTCAGACATTTTTGAGGTCAATTCCATCAGGGGATTATCACGTGAAGCTATCAATGATCTACCTACA
TGTAACCTTCATTCTATAGAGACCACAAATCCTTCTTGCCATGAAACAATCTGTGCAATTTGCTTGACGGACTTCAAGAACGGAGATTGT
GCACGGATGCTTCCTACTTGTGGACATTCTTTCCACTTAAATTGCATAGATGAATGGTTAACAGGAATGGCACTTGCCCGGTTTGTAAAA
GAGATATTTGATXTTGATGGCACTTTGGCCGGAGGAGATGCAGAGCACAAAATGAGAGCAGGAAGGAACCCGTATTTTAGTGCATTAGCC
AACTTTGATGAATTAATTGGTAAATCTCATCATCATACGTACAATTACAACATGCGTCCAAXTGATGGTCAGGCAATTGAATGTAAGGAA
TTAGTGCAAAATCCAATGATGGGTAGTAGCATTATGGTACTACTAAAAGGCTGTACCACCAGTAGTAGAGTAGAGTGTTTGTTAGTTTGG
GACGAGGCGCCTGGACGGTTGTCAAAGACAATCGTCCGAGGCAGTTCACGGCCTGGATGA
Edits in Original Sequence 
(5')XXGGAATCAAATTTGAGGGAGATTTCAGACATTTTTGAGGTCAATTCCATCAGGGGATTATCACGTGAAGCTATCAATGATCTACC
TACATGTAACCTTCATTCTATAGAGACCACAAATCCTTCTTGCCATGAAACAATCTGTGCAATTTGCTTGACGGACTTCAAGAACGGAGA
TTGTGCACGGATGCTTCCTACTTGTGGACATTCTTTCCACTTAAATTGCATAGATGAATGGTTaAACAGGAATGGCACTTGCCCGGTTTG
TAAAAGAGATATTTGATXTTGATGGCACTTTGGCCGGAGGAGATGCAGAGCACAAAATGAGAGCAGGAAGGAACCCGTATTTTAGTGCAT
TAGCCAACTTTGAtTGAATTAATTaGGTAAATCTCATCATCATACGTACAATTACAACATGCGTCCAAXTGATGGTCAGGCAATTGAATG
TAAGGAATTAGTGCAAAATCCAATGATGGGtTAGTAGCATTATGGTACTACTAAAAGGCTGTACCACCAGTAGTAGAGTAGAGTGTTTGT
TAGTTTGGGACGAGGCGCCTGGACGGTTGTCAAAGACAATCGTCCGAGGCAGTTCACGGCCTGGATGA(3')GACCTCAAAAATTTATGC
GGTTCAGATCACGTTTTGTAATTCGATTTTCACATCGTATGGAACTCACAAAAATGTTGTTTTAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan