ESTScan Details for Unigene SGN-U299515

Score 
990
Direction 
Reverse
Predicted Peptide Sequence 
VHFPETRTTLVSASFPRXDRQKSKSERGIDKAMATATTAETAVDEGGRHPNDVGRRSPPRYQKLRFPDGALRLQARNDGIHIINLAKTWE
KLQMAARAIVAIENPQDIIVQSARPYGQRAVLKFAQYTHTHAIAGRHTPGTFTNQLQTSFSEPRLLILTDPRTDHQPIKEAALSNIPTIA
FCDTDSPMRYVDIGIPANNKXETQYWLLVLALSKDGSTDAGVIPQGHKWDVMVDLFFYREPEEAKEPQEEEAPAPDYGDFTSAALGVQDS
WGTSNIPEGEWTMAAQPPIPPAVPAAGWPGEPVPAVSTDGWEATAAPPTAPGVNPVAPPGGGLGVEVFVREHFVNLSSYLKPCNLLSLNI
C
Predicted Coding Sequence 
GTTCATTTTCCGGAAACCAGAACAACCCTAGTTTCCGCCAGTTTCCCCCGCCXCGACAGGCAAAAGAGCAAAAGCGAGAGAGGGATTGAC
AAAGCAATGGCGACTGCTACTACXGCAGAAACAGCTGTCGACGAAGGAGGCCGACATCCAAATGATGTTGGCCGCCGAAGTCCACCTCGG
TACCAAAAACTGCGATTTCCAGATGGAGCGCTACGTCTTCAAGCCCGCAACGACGGAATTCACATCATTAACCTTGCAAAAACATGGGAA
AAGCTTCAAATGGCTGCGAGGGCTATCGTTGCGATTGAGAATCCTCAGGACATTATTGTCCAATCTGCCAGGCCATATGGTCAGAGGGCT
GTCTTGAAATTTGCTCAGTACACCCATACTCATGCAATTGCTGGGCGCCACACTCCTGGTACCTTCACCAACCAGCTCCAAACCTCATTC
AGTGAGCCTCGTCTCCTTATCCTTACAGATCCAAGAACTGATCATCAGCCTATTAAGGAAGCAGCTCTGTCAAACATCCCAACCATTGCT
TTTTGCGACACTGATTCCCCTATGCGATATGTTGATATTGGTATCCCTGCTAACAACAAGGXGGAAACACAGTATTGGTTGCTTGTTCTG
GCTCTTAGCAAGGATGGTTCTACAGATGCTGGTGTTATCCCACAGGGTCACAAGTGGGACGTTATGGTGGACCTGTTTTTCTACAGGGAG
CCTGAGGAGGCCAAGGAACCACAAGAAGAGGAGGCACCTGCTCCAGATTATGGTGACTTTACTTCAGCAGCTCTTGGAGTTCAGGATAGT
TGGGGTACTAGCAATATTCCAGAGGGAGAATGGACAATGGCTGCCCAACCTCCCATTCCTCCTGCAGTTCCTGCAGCTGGTTGGCCTGGA
GAGCCTGTCCCTGCAGTATCAACTGACGGATGGGAGGCAACTGCTGCACCACCAACGGCTCCTGGAGTTAATCCCGTGGCTCCCCCCGGT
GGXGGATTGGGAGTAGAAGTTTTTGTTAGGGAACATTTTGTTAATTTGTCCTCCTACCTTAAGCCATGCAATCTGCTTAGCTTGAACATC
TGTTAG
Edits in Original Sequence 
(5')GTTCATTTTCCGGAAACCAGAACAACCCTAGTTTCCGCCAGTTTCCCCCGCCXCGACAGGCAAAAGAGCAAAAGCGAGAGAGGGAT
TGACAAAGCAATGGCGACTGCTACTACXGCAGAAACAGCTGTCGACGAAGGAGGCCGACATCCAAATGATGTTGGCCGCCGAAGTCCACC
TCGGTACCAAAAACTGCGATTTCCAGATGGAGCGCTACGTCTTCAAGCgCCGCAACGACGGAATTCACATCATTAACCTTGCAAAAACAT
GGGAAAAGCTTCAAATGGCTGCGAGGGCTATCGTTGCGATTGAGAATCCTCAGGACATTATTGTCCAATCTGCCAGGCCATATGGTCAGA
GGGCTGTCTTGAAATTTGCTCAGTACACCCATACTCATGCAATTGCTGGGCGCCACACTCCTGGTACCTTCACCAACCAGCTCCAAACCT
CATTCAGTGAGCCTCGTCTCCTTATCCTTACAGATCCAAGAACTGATCATCAGCCTATTAAGGAAGCAGCTCTGTCAAACATCCCAACCA
TTGCTTTTTGCGACACTGATTCCCCTATGCGATATGTTGATATTGGTATCCCTGCTAACAACAAGGXGGAAACACAGTATTGGTTGCTTG
TTCTGGCTCTTAGCAAGGATGGTTCTACAGATGCgTGGTGTTATCCCACAGGGTCACAAGTGGGACGTTATGGTGGACCTGTTTTTCTAC
AGGGAGCCTGAGGAGGCCAAGGAACCACAAGAAGAGGAGGCACCTGCTCCAGATTATGGTGACTTTACTTCAGCAGCTCTTGGAGTTCAG
GATAGTTGGGGTACTAGCAATATTCCAGAGGGAGAATGGACAATGGCTGCCCAACCTCCCATTCCTCCTGCAGTTCCTGCAGCTGGTTGG
CCTGGAGAGCCTGTCCCTGCAGTATCAACTGACGGATGGGAGGCAACTGCTGCACCACCAACGGCTCCTGGAGTTAATCCCGTGGCTCCC
CCCGGTGGXGGATTGGGAGTAGAAGTTTTTGTTAGGGAACATTTTGTTAATTTGTCCTCCTACCTTAAGCCATGCAATCTGCTTAGCTTG
AACATCTGTTAG(3')TTTATGGTTTGAATCCTGCCTTAGTTATTTTTGTAGCGGTTGAGCTTAAAGAAAATTCTTTGATACAGTTCCAA
AATGGTGTTATATGTTTGTCTCAAAACTATAGAGCTTATCTTTTGCTGAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan