ESTScan Details for Unigene SGN-U299764

Score 
1472
Direction 
Forward
Predicted Peptide Sequence 
MAGSGVFAEITDGDEFKYYFEGEWKKSASGKSVSIINPTTRKTQYKVQACTQEEVNKVMEIAKAAQKLWAKTPLWKRAELLHKAAAILKE
HKAPIAECLVKEIAKPAKDAVTEVVRSGDLVSYTAEEGVRILGQGTYLVSDSFPGNERTKYCLSSKIPLGVVLAIPPFNYPVNLAVSKLA
PALIAGNSIVLKPPTQGAVSALHMVHCFHLAGFPKGLINCVTGKGSEIGDFLTMHPGVNCISFTGGDTGIAISKKAGMIPLQMELGGKDA
CIVLEDADLDLVAANIVKGGFSYSGQRCTAVKVVLVMESVADDLVAKVNAKVAKLKVGPPEDDCDITAVVSESSANFIEGLVMDAKQKGA
TFCQEYKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRITSAEEGIHHCNASNFGLHGGVFTKDIDKAMLISDAMXDGNRPDYSAPA
RGPDHFHFQGIX
Predicted Coding Sequence 
ATGGCTGGGAGTGGAGTTTTTGCTGAGATTACTGATGGAGATGAGTTCAAGTACTACTTTGAAGGGGAGTGGAAGAAGTCTGCTTCTGGG
AAATCTGTTTCTATCATTAATCCAACTACGCGAAAAACTCAGTACAAAGTACAAGCATGTACACAAGAAGAGGTTAACAAGGTAATGGAA
ATAGCTAAGGCTGCACAAAAGTTATGGGCCAAAACTCCACTTTGGAAGCGCGCAGAGCTGCTTCACAAGGCCGCTGCTATTCTCAAAGAG
CACAAAGCGCCAATTGCAGAATGTCTAGTAAAGGAGATTGCAAAACCAGCAAAAGATGCTGTCACTGAGGTCGTGAGGTCTGGAGATCTG
GTTTCTTACACTGCTGAAGAAGGAGTAAGGATTTTGGGACAGGGCACATACTTGGTCTCTGATAGTTTTCCTGGAAATGAGAGGACCAAA
TACTGCCTCAGTTCCAAGATCCCACTCGGTGTTGTCCTAGCCATTCCCCCCTTTAACTATCCTGTTAACCTTGCCGTCTCCAAACTAGCA
CCTGCCTTGATTGCTGGGAATTCTATTGTTCTCAAGCCTCCAACTCAGGGTGCTGTGTCAGCCCTACATATGGTTCATTGTTTCCACTTA
GCTGGCTTTCCAAAGGGCCTTATTAACTGTGTCACTGGGAAAGGTTCTGAGATTGGTGATTTCCTCACCATGCATCCTGGTGTGAACTGT
ATAAGCTTTACTGGCGGTGACACTGGGATTGCGATCTCAAAGAAAGCAGGCATGATCCCCTTACAAATGGAGCTGGGAGGAAAAGATGCT
TGTATTGTCCTTGAGGATGCAGATTTAGATTTGGTTGCAGCAAATATTGTCAAAGGAGGTTTTTCTTACAGTGGTCAAAGGTGCACAGCT
GTTAAGGTTGTTTTGGTGATGGAATCTGTGGCTGATGATCTTGTTGCAAAAGTAAATGCCAAAGTAGCAAAACTAAAAGTTGGACCTCCC
GAAGATGATTGTGATATCACTGCAGTTGTCTCAGAGTCATCGGCAAACTTCATTGAAGGGTTAGTTATGGATGCTAAGCAGAAGGGCGCA
ACATTTTGCCAGGAATACAAAAGAGAGGGCAATCTCATCTGGCCACTTTTGCTAGACCATGTTAGGCCAGACATGAGGATAGCGTGGGAG
GAGCCATTTGGGCCAGTTTTGCCAGTGATTAGGATTACCTCTGCTGAAGAAGGAATTCACCATTGCAATGCAAGCAATTTTGGCCTACAC
GGTGGTGTCTTCACCAAAGATATCGACAAAGCTATGTTGATCAGCGATGCCATGXTAGACGGGAACCGTCCAGATTACTCCGCTCCAGCT
CGTGGACCGGATCATTTTCACTTCCAGGGAATTAAX
Edits in Original Sequence 
CCCAAATGTGGCTAACCATTTTCCTCTATTTATAGGTCCCCACCTCCAAATACTCACCGGTGATCATCACTCGCTAGGTAGCTACTCCCA
GGGCAGCAGAAGAAACAACCTGATTCTGTTTCTCTGAGCTTTGAAGCTAAAAATTTCCCTCAGAGGGTTGATCAGTCTTGAGAGGAAAAG
CAGTTTAGTGTCTAAATTAGCA
(5')ATGGCTGGGAGTGGAGTTTTTGCTGAGATTACTGATGGAGATGAGTTCAAGTACTACTTTGAAG
GGGAGTGGAAGAAGTCTGCTTCTGGGAAATCTGTTTCTATCATTAATCCAACTACGCGAAAAACTCAGTACAAAGTACAAGCATGTACAC
AAGAAGAGGTTAACAAGGTAATGGAAATAGCTAAGGCTGCACAAAAGTTATGGGCCAAAACTCCACTTTGGAAGCGCGCAGAGCTGCTTC
ACAAGGCCGCTGCTATTCTCAAAGAGCACAAAGCGCCAATTGCAGAATGTCTAGTAAAGGAGATTGCAAAACCAGCAAAAGATGCTGTCA
CTGAGGTCGTGAGGTCTGGAGATCTGGTTTCTTACACTGCTGAAGAAGGAGTAAGGATTTTGGGACAGGGCACATACTTGGTCTCTGATA
GTTTTCCTGGAAATGAGAGGACCAAATACTGCCTCAGTTCCAAGATCCCACTCGGTGTTGTCCTAGCCATTCCCCCCTTTAACTATCCTG
TTAACCTTGCCGTCTCCAAACTAGCACCTGCCTTGATTGCTGGGAATTCTATTGTTCTCAAGCCTCCAACTCAGGGTGCTGTGTCAGCCC
TACATATGGTTCATTGTTTCCACTTAGCTGGCTTTCCAAAGGGCCTTATTAACTGTGTCACTGGGAAAGGTTCTGAGATTGGTGATTTCC
TCACCATGCATCCTGGTGTGAACTGTATAAGCTTTACTGGCGGTGACACTGGGATTGCGATCTCAAAGAAAGCAGGCATGATCCCCTTAC
AAATGGAGCTGGGAGGAAAAGATGCTTGTATTGTCCTTGAGGATGCAGATTTAGATTTGGTTGCAGCAAATATTGTCAAAGGAGGTTTTT
CTTACAGTGGTCAAAGGTGCACAGCTGTTAAGGTTGTTTTGGTGATGGAATCTGTGGCTGATGATCTTGTTGCAAAAGTAAATGCCAAAG
TAGCAAAACTAAAAGTTGGACCTCCCGAAGATGATTGTGATATCACTGCAGTTGTCTCAGAGTCATCGGCAAACTTCATTGAAGGGTTAG
TTATGGATGCTAAGCAGAAGGGCGCAACATTTTGCCAGGAATACAAAAGAGAGGGCAATCTCATCTGGCCACTTTTGCTAGACCATGTTA
GGCCAGACATGAGGATAGCGTGGGAGGAGCCATTTGGGCCAGTTTTGCCAGTGATTAGGATTACCTCTGCTGAAGAAGGAATTCACCATT
GCAATGCAAGCAATTTTGGCCTACACGGTGGTGTCTTCACCAAAGATATCGACAAAGCTATGTTGATCAGCGATGCCATGXTAGACGGGA
ACCGTCCAGATTaACTCCGCTCCAGCTCGTGGACCGGATCATTTTCACTTCCAGGGAATTAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan