Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U299839

Score 
224
Direction 
Forward
Predicted Peptide Sequence 
MVKINKFILSLAVSIIAVIASWNPSAVTANSEGDALYSLRRSLFDPDNVLQSWDPNLETPVLGFMSPATKITMSRAVDLGNSNLSGHLVL
DLGKLEHLQYLELYKNNIQGSIPVELGNLRSLISLDLYNNNLTGVVPHSLGKLKSLVFLRLNDNHLTGPIPRSLAGISSLKVVDVSNNXF
VGTIPTSGPFEHIPLNNFENNPRLEGPELQGLASYKQTARRITIRYNRLQWLFEVYMLCLYLNSXPVGVLCLKMLGHVIFADYLCRLAFK
LPKSV
Predicted Coding Sequence 
ATGGTGAAGATTAACAAATTTATCTTGTCTTTAGCAGTTAGTATTATTGCAGTAATAGCATCGTGGAATCCGAGTGCCGTGACTGCAAAT
TCTGAAGGGGACGCGCTCTATTCGCTTCGCCGGAGTCTATTCGACCCCGATAACGTTCTTCAGAGCTGGGATCCGAATCTTGAAACCCCT
GTACTTGGTTTCATGTCACCTGCAACCAAGATAACCATGTCACGCGCXGTGGACCTCGGCAACTCAAATTTGTCTGGCCATCTAGTGCTT
GATTTGGGGAAGCTTGAACATCTGCAGTATCTAGAGCTTTACAAAAATAATATCCAAGGGTCAATCCCTGTTGAGCTTGGTAACTTGAGG
AGCCTAATTAGTTTGGACTTATACAACAATAATCTCACAGGTGTCGTTCCTCATTCATTGGGAAAGTTGAAGTCTCTTGTATTCTTGCGC
CTGAATGATAACCACTTAACCGGGCCAATTCCAAGGTCACTTGCTGGAATTTCTTCCCTGAAAGTTGTGGATGTCTCAAATAATGXATTT
GTGGGAACAATTCCTACCAGTGGTCCATTTGAGCACATACCATTAAACAACTTTGAGAACAATCCTCGTCTTGAAGGTCCAGAACTGCAA
GGGCTCGCAAGTTACAAACAAACTGCTCGTAGGATAACTATTAGATACAACAGGCTACAATGGCTCTTTGAGGTTTATATGTTGTGTTTG
TATCTTAACAGTGXTCCTGTTGGTGTGTTGTGCCTTAAAATGCTTGGACATGTAATATTTGCAGACTATCTTTGTAGACTGGCATTTAAG
TTACCGAAATCTGTATGA
Edits in Original Sequence 
CCTCTCTCTCCTTTTTCTCTTTCTCCTCATCCTCTGCAAAATCAAAACCAGAAATCAGGAATCGAAGCCCTAGAATTTCTCTCGATATTC
ATCAGTACAAGT
(5')ATGGTGAAGATTAACAAATTTATCTTGTCTTTAGCAGTTAGTATTATTGCAGTAATAGCATCGTGGAATCCGAG
TGCCGTGACTGCAAATTCTGAAGGGGACGCGCTCTATTCGCTTCGCCGGAGTCTATTCGACCCCGATAACGTTCTTCAGAGCTGGGATCC
GAATCTTGtAAACCCCTGTACTTGGTTTCATGTCACCTGCAACCAAGATAACCATGTCACGCGCXGTGGACCTCGGCAACTCAAATTTGT
CTGGCCATCTAGTGCTTGATTTGGGGAAGCTTGAACATCTGCAGTATCTAGAGCTTTACAAAAATAATATCCAAGGGTCAATCCCTGTTG
AGCTTGGTAACTTGAGGAGCCTAATTAGTTTGGACTTATACAACAATAATCTCACAGGTGTCGTTCCTCATTCATTGGGAAAGTTGAAGT
CTCTTGTATTCTTGCGCCTGAATGATAACCACTTAACCGGGCCAATTCCAAGGTCACTTGCTGGAATTTCTTCCCTGAAAGTTGTGGATG
TCTCAAATAATGXATTTGTGcGGAACAATTCCTACCAGTGGTCCATTTGAGCACATACCATTAAACAACTTTGAGAACAATCCTCGTCTT
GAAGGTCCAGAACTGCAAGGGCTCGCAAGTTACgAAACAAACTGCTCGTAGGATAACTATTAGATACAACAGGCTACAATGGCTCTTTGA
GGTTTATATGTTGTGTTTGTATCTTAACAGTGXTCCTGTTGGTGTGTTGTGCCTTAAAATGCTTGGACATGTAATATTTGCAGACTATCT
TTGTAGACTGGCATTTAAGTTACCGAAATCTGTATGA(3')TCAGTGTACTTCTAGCACTGTAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan