ESTScan Details for Unigene SGN-U299859

Score 
1214
Direction 
Forward
Predicted Peptide Sequence 
MSEEVKDAPASPEVVDAPAPSKAKDAPSPAAEEKAGAMENKPSSESTSVETQSEQRRATTTTSAAGVPLQNPFDFSAMTGLLNDPSIKEL
AEQIAKDPSFNQMAEQLQKTFQGTSVDEGIPQFDTQQYYTTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLENLTNPVHKDQLEERMSR
IKEDPSLKPILDEIETGGPAAMMRYWNDKEVLQKLGEAMGFAVAGEPGSSADNAEPDEAEEANEDESIVHHTAX
Predicted Coding Sequence 
ATGTCTGAGGAGGTTAAAGATGCTCCAGCTTCCCCAGAGGTTGTAGATGCTCCAGCACCGTCGAAGGCTAAGGATGCTCCTTCACCAGCA
GCTGAAGAAAAGGCTGGTGCCATGGAGAATAAACCTAGTTCTGAATCAACCTCTGTGGAGACACAATCAGAACAGAGGAGGGCTACAACC
ACAACCTCTGCAGCTGGAGTGCCGCTACAAAATCCTTTCGATTTCTCTGCAATGACGGGCCTACTAAATGACCCGAGCATCAAAGAATTA
GCCGAACAGATTGCAAAGGACCCTTCTTTTAATCAAATGGCAGAGCAGCTTCAGAAGACCTTTCAGGGTACTTCAGTGGATGAGGGTATC
CCTCAGTTTGATACACAGCAATACTACACTACAATGCAGCAGGTTATGCAAAATCCACAATTTATGACAATGGCTGAGCGGCTTGGCAAT
GCTTTAATGCAGGATCCATCTATGTCCAGCATGCTTGAGAATTTGACCAATCCAGTTCACAAAGACCAGCTTGAAGAACGAATGTCACGC
ATCAAGGAGGATCCTTCTTTGAAGCCTATTTTGGATGAGATAGAGACAGGAGGTCCAGCTGCAATGATGAGGTATTGGAATGATAAGGAG
GTTCTACAGAAGTTGGGTGAAGCAATGGGTTTTGCTGTTGCTGGAGAACCAGGTTCCTCTGCTGACAATGCAGAGCCAGATGAAGCAGAG
GAAGCAAATGAAGATGAATCTATTGTTCATCATACTGCTAGX
Edits in Original Sequence 
CCCGGGCTGCAGATTCGGCACGAGGCCCAAATCACTCTTCAATCACACACTTCCTCTCTCTTTCTCCGTCTCGCGTATATATCATCCTCT
TCCAGTCTTCCTTCACAGCAAGCAAGGAACTTCCACATCTCTCTCCAATCTCTCAAGCC
(5')ATGTCTGAGGAGGTTAAAGATGCTCCA
GCTTCCCCAGAGGTTGTAGATGCTCCAGCACCGTCGAAGGCTAAGGATGCTCCTTCACCAGCAGCTGAAGAAAAGGCTGGTGCCATGGAG
AATAAACCTAGTTCTGAATCAACCTCTGTGGAGACACAATCAGAACAGAGGAGGGCTACAACCACAACCTCTGCAGCTGGAGTGCCGCTA
CAAAATCCTTTCGATTTCTCTGCAATGACGGGCCTACTAAATGACCCGAGCATCAAAGAATTAGCCGAACAGATTGCAAAGGACCCTTCT
TTTAATCAAATGGCAGAGCAGCTTCAGAAGACCTTTCAGGGTACTTCAGTGGATGAGGGTATCCCTCAGTTTGATACACAGCAATACTAC
ACTACAATGCAGCAGGTTATGCAAAATCCACAATTTATGACAATGGCTGAGCGGCTTGGCAATGCTTTAATGCAGGATCCATCTATGTCC
AGCATGCTTGAGAATTTGACCAATCCAGTTCACAAAGACCAGCTTGAAGAACGAATGTCACGCATCAAGGAGGATCCTTCTTTGAAGCCT
ATTTTGGATGAGATAGAGACAGGAGGTCCAGCTGCAATGATGAGGTATTGGAATGATAAGGAGGTTCTACAGAAGTTGGGTGAAGCAATG
GGTTTTGCTGTTGCTGGAGAACCAGGTTCCTCTGCTGACAATGCAGAGCCAGATGAAGCAGAGGAAGCAAATGAAGATGAATCTATTGTT
CATCATACTGCTAGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan