ESTScan Details for Unigene SGN-U299863

Score 
581
Direction 
Forward
Predicted Peptide Sequence 
YQTIKSFKTAHHLSNHRVLFEIMCRGSQGIEEREPLKIKAFHVHLSFSITTNLLQIKKPAFLYDSLTLHFLPRINGASLEIEGSSLRPDT
PGFITLHPLVSSSAAAHHHHHHHHQYGSRERVRVSQGSRFEIYASDDVKLLKGTFRKDGDRDNEDPRGVADVNKWKLDCRCQLELGEDSH
FLREAEXVRGGGRTRGGVHDQRQGGDGTPPEKGKAALFEWLEEIPEEREVDELMAAAAAAAAPPAGSDDEKAGSVGDRRMDDGTCSADTV
TVPEAEGGGYWAAVEGVGIWVMCLGGVAYLLSKTSSTRVLARTATRRQNGLSFFNKIKYYHWXW
Predicted Coding Sequence 
XCTTATCAAACTATCAAATCATTTAAAACTGCTCATCATCTATCTAACCACCGAGTGCTGTTTGAAATAATGTGCAGAGGGTCTCAAGGT
ATCGAAGAGCGAGAGCCCTTGAAGATCAAAGCTTTTCACGTACATTTATCGTTCTCCATCACCACCAACTTGCTTCAGATCAAGAAACCG
GCCTTCTTGTATGATTCTCTAACCCTGCATTTCCTTCCTCGAATCAATGGTGCTTCCTTGGAGATCGAGGGGTCGAGCCTTCGTCCCGAT
ACCCCTGGCTTTATTACGCTGCACCCACTTGTATCTTCTTCGGCCGCCGCCCATCATCATCATCATCATCATCATCAGTACGGTAGTAGG
GAGAGAGTGAGGGTTAGCCAAGGCTCCCGCTTTGAGATCTACGCTAGTGATGATGTCAAGTTGTTGAAGGGAACTTTTAGGAAGGACGGC
GATCGCGATAATGAGGATCCGCGGGGAGTAGCGGATGTCAATAAGTGGAAATTGGATTGTAGGTGCCAGTTGGAGTTGGGGGAGGATTCT
CATTTCCTGCGGGAGGCTGAGGXTGTGCGTGGAGGTGGAAGGACGCGGGGTGGGGTCCATGATCAGCGACAAGGTGGCGATGGTACTCCC
CCGGAGAAGGGGAAGGCGGCACTTTTTGAATGGTTGGAGGAGATTCCTGAGGAGAGGGAAGTTGATGAACTGATGGCGGCGGCTGCTGCT
GCTGCTGCTCCTCCTGCXGGTTCTGATGATGAGAAAGCCGGGAGTGTCGGGGACCGCCGGATGGACGACGGTACTTGTAGTGCGGATACA
GTTACAGTACCAGAAGCAGAAGGAGGCGGATATTGGGCCGCTGTGGAAGGTGTTGGGATTTGGGTCATGTGCTTGGGTGGTGTTGCCTAC
TTGCTTTCTAAAACTTCTTCCACCCGGGTCCTTGCTAGAACCGCCACAAGAAGGCAAAACGGATTATCGTTTTTCAACAAAATCAAATAC
TACCACTGGTAGTGG
Edits in Original Sequence 
(5')XCTTATCAAACTATCAAATCATTTAAAACTGCTCATCATCTATCTAACCACCGAGTGCTGTTTGAAATAATGTGCAGAGGGTCTCA
AGGTATCGAAGAGCGAGAGCCCTTGAAGATCAAAGCTTTTCACGTACATTTATCGTTCTCCATCACCACCAACTTGCTTCAGATCAAGAA
ACCGGCCTTCTTGTATGATTCTCTAACCCTGCATTTCCTTCCTCGAATCAATGGTGCTTCCTTGGAGATCGAGGGGTCGAGCCTTCGTCC
CGATACCCCTGGCTTTATTACGCTGCACCCACTTGTATCTTCTTCGGCCGCCGCCCATCATCATCATCATCATCATCATCAGTACGGTAG
TAGGGAGAGAGTGAGGGTTAGCCAAGGCTCCCGCTTTGAGATCTACGCTAGTGATGATGTCAAGTTGTTGAAGGGAACTTTTAGGAAGGA
CGGCGATCGCGATAATGAGGATCCGCGGGGAGTAGCGGATGTCAATAAGTGGAAATTGGATTGTAGGTGCCAGTTGGAGTTGGGGGAGGA
TTCTCATTTCCTGCGGGAGGCTGAGGXTGTGCGTGGAGGTGGAAGGACGCGGGGTGGGGTCCATGATCAGCGACAAGGTGGCGATGGTAC
TCCCCCGGAGAAGGGGAAGGCGGCACTgTTTTGAATGGTTGGAGGAGATTCCTGAGGAGAGGGAAGTTGATGAAtCTGATGGCGGCGGCT
GCTGCTGCTGCTGCTCCTCCTGCXGGTTCTGATGATGAGAAAGCCGGGAGTGTCGGGGACCGCCGGATGGACGACGGTACTTGTAGTGCG
GATACAGTTACAGTACCAGAAGCAGAAGGAGGCGGATATTGGGCCGCTGTGGAAGGTGTTGGGATTTGGGTCATGTGCTTGGGTGGTGTT
GCCTACTTGCTTTCTAAAACTTCTTCCACCCGGGTCCTTGCTAGAACCGCCACAAGAAGGCAAAACGGATTATCGTTTTTCAACAAAATC
AAATACTACCACTGGTAGTGG(3')TAGAATTTCCTGGTTACTTTCCGATTTGTTTATTTTTATTTTGACTTTCCTCCCCTTCTGGTGAG
TGTACAGCAGTCCAGAAACGTGGCAAAGACCATAATACACTCGCGGTATCTGAGACGATTATTTCGTGGATTTGCATTTGTGCAGTTCTC
CGTGGGTCGACCCTGTTCTTCCTCTCTTCTGGCTGGGCAGGGCATGGCATGGCATGGCAGGCCTCAAACATTAAGTCATTTTGAATGGCA
GTACAGGAGTCACTGTAATGCGAAGACAGGCGACAAATAGAGAAGAAAAAAAAAAAGAAATCAAGTAGCTTAAGAAAATGATAATGGAGG
TTAATGTAAATTTAGGAGTTGGAAAGGAGGTTGAATTGTAATTTGAACCTTAATAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan