Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U299877

Score 
1348
Direction 
Forward
Predicted Peptide Sequence 
VAVSSLRCPFXLQLSEKVENRRKSQAKMFGRAPKKSDNTRYYEILGVSKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEVLSD
PEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQTFFNGDPFNRGSSRGRRQRRGEDVVHPLKVSLEDLYSGTTKKLSLPGMLFVQSXSGK
GSKSGASTKCSGCQGTGMKVTIRQLGPGMIQQMQHPCNECKGTGDTINDKDRCPQCKGEKVVPEKKVLEVHVEKGMQNGQKITFPGEADE
APDTATGDIVFVVQQKEHPKLKRKHDDIFVEHTLSLTEAXLRLPVHLDAPGGRQLLIKSKPGEVIKPDQFKAIDDEGMPMYQRPFMRGKM
YIHFTVEFPDSLSPDQVKALEGILPPKPQSQLTDMELDECEETTLHDVNIEEEMRRKQAAQQEAYEEDDDMHGGGAQRXAMCSAVIP
Predicted Coding Sequence 
GTCGCTGTTTCTAGCCTTCGTTGCCCTTTTXCTCTTCAGCTCTCTGAAAAAGTCGAAAATCGTCGTAAATCACAAGCGAAGATGTTTGGG
AGGGCGCCTAAGAAAAGTGATAATACGCGGTACTATGAGATATTAGGGGTGTCGAAGAATGCTTCTCCTGAAGATCTTAAGAAAGCTTAC
AAGAAAGCCGCCATCAAGAACCATCCTGATAAGGGCGGCGACCCTGAGAAGTTTAAGGAGCTAGCTCATGCTTATGAGGTCTTGAGTGAC
CCAGAAAAAAGGGAGATTTATGATCAGTATGGTGAAGATGCGCTCAAGGAGGGAATGGGTGGTGGCGGAGGCATGCATGATCCATTTGAC
ATCTTCCAAACTTTCTTTAATGGAGATCCATTTAATAGAGGTAGCAGTAGGGGACGAAGACAGAGGAGGGGTGAGGATGTAGTTCATCCA
TTGAAGGTGTCGTTGGAAGATCTGTACAGTGGTACAACCAAGAAGCTCTCTCTTCCCGGAATGTTATTTGTTCAAAGTGXTAGTGGAAAA
GGATCAAAATCTGGAGCTTCAACAAAGTGTTCCGGTTGTCAAGGTACTGGTATGAAGGTGACAATTAGACAGCTTGGTCCTGGAATGATC
CAGCAAATGCAACATCCTTGCAATGAATGCAAAGGAACTGGAGATACTATCAATGACAAGGACCGCTGTCCACAATGTAAAGGTGAAAAA
GTTGTCCCAGAGAAGAAAGTATTGGAAGTTCATGTGGAGAAGGGCATGCAAAATGGCCAGAAGATTACTTTCCCTGGAGAGGCAGATGAA
GCGCCTGACACTGCCACTGGGGACATAGTGTTTGTTGTCCAGCAGAAAGAGCATCCAAAGCTCAAGAGAAAACATGATGATATTTTTGTC
GAGCATACTTTGTCTCTCACTGAGGCAXCTCTGCGGCTTCCAGTTCATCTTGACGCACCTGGTGGAAGGCAACTTCTTATAAAATCAAAG
CCAGGAGAAGTTATTAAGCCTGATCAATTCAAGGCAATCGATGATGAAGGGATGCCAATGTACCAGAGGCCATTTATGCGGGGTAAAATG
TATATTCATTTCACTGTAGAGTTCCCAGACTCTCTGAGCCCCGACCAGGTGAAGGCTTTGGAAGGAATCCTTCCTCCAAAGCCACAATCA
CAGTTGACTGACATGGAGCTTGATGAGTGTGAGGAGACAACATTGCATGATGTCAACATTGAGGAGGAGATGAGGAGGAAGCAAGCTGCT
CAGCAAGAGGCTTACGAGGAAGATGATGACATGCATGGTGGTGGAGCTCAGAGAGXTGCAATGTGCTCAGCAGTGATCCCTTGA
Edits in Original Sequence 
(5')GTCGCTGTTTCTAGCCTTCGTTGCCCTTTTXCTCTTCAGCTCTCTGAAAAAGTCGAAAATCGTCGTAAATCACAAGCGAAGATGTT
TGGGAGGGCGCCTAAGAAAAGTGATAATACGCGGTACTATGAGATATTAGGGGTGTCGAAGAATGCTTCTCCTGAAGATCTTAAGAAAGC
TTACAAGAAAGCCGCCATCAAGAACCATCCTGATAAGGGCGGCGACCCTGAGAAGTTTAAGGAGCTAGCTCATGCTTATGAGGTCTTGAG
TGACCCAGAAAAAAGGGAGATTTATGATCAGTATGGTGAAGATGCGCTCAAGGAGGGAATGGGTGGTGGCGGAGGCATGCATGATCCATT
TGACATCTTCCAAACTTTCTTTAATGGAGATCCATTTAATAGAGGTAGCAGTAGGGGACGAAGACAGAGGAGGGGTGAGGATGTAGTTCA
TCCATTGAAGGTGTCGTTGGAAGATCTGTACAGTGGTACAACCAAGAAGCTCTCTCTgTCCCGGAATGTTATTTGTTCAAAGTGXTAGTG
GAAAAGGATCAAAATCTGGAGCTTCAACAAAGTGTTCCGGTTGTCAAGGTACTGGTATGAAGGTGACAATTAGACAGCTTGGTCCTGGAA
TGATCCAGCAAATGCAACATCCTTGCAATGAATGCAAAGGAACTGGAGATACTATCAATGACAAGGACCGCTGTCCACAATGTAAAGGTG
AAAAAGTTGTCCCAGAGAAGAAAGTATTGGAAGTTCATGTGGAGAAGGGCATGCAAAATGGCCAGAAGATTACTTTCCCTGGAGAGGCAG
ATGAAGCGCCTGACACTGCCACTGGGGACATAGTGTTTGTTGTCCAGCAGAAAGAGCATCCAAAGCTCAAGAGAAAACATGATGATATTT
TTGTCGAGCATACTTTGTCTCTCACTGAGGCAXCTCTGCGGCTTCCAGTTCATCTTGACGCACCTGGaTGGAAGGCAACTTCTTATAAAA
TCAAAGCCAGGAGAAGTTATTAAGCCTGATCAATTCAAGGCAATCGATGATGAAGGGATGCCAATGTACCAGAGGCCATTTATGCGGGGT
AAAATGTATATTCATTTCACTGTAGAGTTCCCAGACTCTCTGAGCCCCGACCAGGTGAAGGCTTTGGAAGGAATCCTTCCTCCAAAGCCA
CAATCACAGTTGACTGACATGGAGCTTGATGAGTGTGAGGAGACAACATTGCATGATGTCAACATTGAGGAGGAGATGAGGAGGAAGCAA
GCTGCTCAGCAAGAGGCTTACGAGGAAGATGATGACATGCATGGTGGTGGAGCTCAGAGAGXTGCAATGTGCTCAGCAGTGATCCCTTGA
(3')AGATTTTTAGGACGAGATGATTTTGTACTTTCTCAAATGCCATGAGCTTATAAGAGTTGCTGTTCATGTATTTGCTTTGGCAGATT
AATCTAGTTTTGTCTGCAGTTGTTGATCTTGAAGGAGAGAATTTACTTGGCACAATTTGCTCCTCTCGCTTTCTTTTTTTTCCCCTTTTT
CTTGGGGAGAAACAATTGGGCTTTTGGCAGAAAAGATCAGTAGTAGTAGTTCCCCTGGTCTAGAAAAGTACTATGTTTTTGCACACGCTG
ATTTTACAAAATCTGTCTACTGACGAAAGAATCTGAACTGTTATTGGTGCAAGATTTCCTTTACTAAATGTGTTGATCTAACCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan