ESTScan Details for Unigene SGN-U299892

Score 
99
Direction 
Forward
Predicted Peptide Sequence 
MENGNECEGAGNKMHSQATTTAGKVIRCKAAVAYGPGQPMVVEDILVDPPKAMEVRVKILYTSICHSDLSAWRGENEAQRVYPRIFGHEA
SGLIESVGEGVSELKWGTMWCPYSTGNAASAPIANLRRPTFAGDSGGSIQERDDQHGTTRFSTQDGKPVYHFLNTSTFTEYTVLDSASSS
PLTLKLPLRKCPCSAVAFPXGLGAVWNTANVQAESTVAVFGLGAVGLAVVEGARARGASKIIGVDINPDKRTKGQAIGITDXINPNDLX
Predicted Coding Sequence 
ATGGAGAACGGAAACGAATGTGAGGGTGCGGGTAACAAGATGCACTCGCAGGCCACGACGACGGCAGGGAAGGTGATCAGATGCAAAGCT
GCGGTTGCGTATGGTCCAGGGCAGCCCATGGTGGTGGAAGACATCCTGGTTGATCCCCCCAAGGCAATGGAGGTCCGGGTCAAGATTCTC
TACACTTCTATTTGCCACTCCGATCTTAGTGCCTGGCGAGGCGAGAACGAAGCCCAGCGGGTGTACCCACGTATTTTTGGACACGAAGCA
TCTGGATTGATAGAAAGCGTGGGAGAAGGGGTTAGTGAGTTGAAATGGGGGACCATGTGGTGCCCATATTCAACGGGGAATGCGGCAAGT
GCGCCTATTGCAAATCTGAGAAGACCAACCTTTGCCGGAGATTCCGGTGGATCCATTCAAGAGCGTGATGACCAGCACGGAACCACTCGG
TTTTCTACCCAAGACGGCAAACCAGTGTACCATTTCCTCAACACTTCCACTTTCACCGAATACACTGTTCTGGATTCTGCCTCGTCGTCG
CCGTTGACTCTCAAGCTCCCCTTGAGAAAATGTCCTTGCTCAGCTGTGGCGTTTCCACXGGGTCTTGGAGCCGTGTGGAATACTGCTAAC
GTCCAAGCTGAATCTACTGTTGCAGTCTTTGGCCTTGGAGCGGTGGGACTCGCTGTCGTAGAAGGCGCACGAGCTCGTGGAGCGTCTAAA
ATTATAGGAGTTGATATTAACCCCGACAAACGCACTAAAGGTCAAGCGATTGGAATTACCGACXTCATAAACCCCAATGATCTTGAX
Edits in Original Sequence 
GACAGACAGACAGACAGAAGAAACTTTGTCAAGTAGAGAGGGTAATTAAGAGAAG(5')ATGGAGAACGGAAACGAATGTGAGGGTGCGG
GTAACAAGATGCACTCGCAGGCCACGACGACGGCAGGGAAGGTGATCAGATGCAAAGCTGCGGTTGCGTATGGTCCAGGGCAGCCCATGG
TGGTGGAAGACATCCTGGTTGATCCCCCCAAGGCAATGGAGGTCCGGGTCAAGATTCTCTACACTTCTATTTGCCACTCCGATCTTAGTG
CCTGGCGAGGCGAGAACGAAGCCCAGCGGGTGTACCCACGTATTTTTGGACACGAAGCATCTGGATTGATAGAAAGCGTGGGAGAAGGGG
TTAGTGAGTTGAAATcGGGGGACCATGTGGTGCCCATATTCAACGGGGAATGCGGCAAGTGCGCCTATTGCAAATCTGAGAAGACCAACC
TTTGCCGGAGATTCCgGGTGGATCCATTCAAGAGCGTGATGACCAGCgACGGAACCACTCGGTTTTCTACCCAAGACGGCAAACCAGTGT
ACCATTTCCTCAACACTTCCACTTTCACCGAATACACTGTTCTGGATTCTGCCTgCGTCGTCGCCGTTGACTCTCAAGCTCCCCTTGAGA
AAATGTCCTTGCTCAGCTGTGGCGTTTCCACXGGGTCTTGGAGCCGTGTGGAATACTGCTAACGTCCAAGCTGAATCTACTGTTGCAGTC
TTTGGCCTTGGAGCGGTGGGACTCGCTGTCGTAGAAGGCGCACGAGCTCGTGGAGCGTCTAAAATTATAGGAGTTGATATTAACCCCGAC
AAACGCACTAAAGGTCAAGCGATTGGAATTACCGACXTCATAAACCCCAATGATCTTGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan