ESTScan Details for Unigene SGN-U299902

Score 
854
Direction 
Forward
Predicted Peptide Sequence 
QGHVDVVNLLLDIDPNIAKIARNNGKTVLHTAARMGHLEVVKSLLSKDPSIGFRTDKKGQTALHMAVKGQNVEIVQELIKPDSSVLSLGD
NKGNTGTPHRNKEGSNSMVQSLIASEGIEINATNKAGETPLDISEKLAMPELDSILKEAGALHSQDHGKPPNAAKQLKQTVSDIKHDVQS
QLQQCRQTGFRVRKIAKKVKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVEEQTPGSSLGQAHIAKNAAFLVFILCDSLALFI
SLAVVVVQTSIVXDRTEGKEATYVRDKQAYVDGMPLHFNAFISLTYVVVGRHEQWLAVYATIIGGTIMLATIGSMCFCVVRHRLEDSKMR
NIRRAETLSGSFSVSMVSDPELYGEKYKRMYAXVGTVSSCERGHLEQKDTFNDFCTSINXPAILAGSYCVELHLAL
Predicted Coding Sequence 
XCTCAAGGACACGTTGATGTAGTCAATCTGCTTCTTGATATTGATCCTAACATCGCTAAGATAGCTCGAAACAATGGCAAGACTGTGCTT
CATACGGCTGCAAGAATGGGTCACTTGGAAGTTGTGAAATCACTTTTAAGCAAGGATCCCAGCATAGGATTCAGGACTGACAAGAAAGGT
CAAACTGCACTCCACATGGCTGTGAAGGGCCAAAACGTGGAGATTGTACAGGAATTAATAAAACCTGACTCCTCTGTTCTGAGCTTGGGA
GATAACAAAGGAAACACXGGCACTCCACATCGCAACAAGGAAGGGTCGAACTCAATGGTACAGAGTCTGATAGCAAGTGAAGGCATTGAG
ATCAATGCAACTAATAAGGCTGGAGAAACCCCCCTTGATATTTCGGAAAAGCTTGCAATGCCAGAATTAGATAGCATTTTAAAAGAGGCA
GGAGCTCTTCATTCTCAAGATCATGGAAAACCACCAAATGCTGCAAAGCAACTCAAACAGACTGTCAGTGACATAAAACATGACGTGCAG
TCCCAACTCCAACAATGCCGTCAGACTGGCTTTAGAGTAAGGAAGATTGCTAAGAAAGTGAAGAAGCTCCACATTAGTGGCCTTAACAAT
GCCATCAACTCTGCAACTGTTGTTGCTGTCCTGATTGCAACCGTTGCTTTTGCAGCCATCTTCACTGTGCCCGGCCAGTATGTCGAGGAA
CAAACACCAGGATCTTCACTTGGGCAAGCCCATATAGCTAAAAATGCAGCTTTCTTAGTCTTCATTTTGTGCGATAGTCTGGCCTTATTT
ATCTCCCTTGCTGTTGTGGTGGTACAGACATCTATTGTTGXTGATAGAACAGAGGGCAAAGAAGCAACTTATGTTCGTGATAAACAAGCT
TATGTGGACGGCATGCCTCTTCATTTCAATGCCTTTATTTCTCTCACCTATGTGGTTGTTGGACGTCATGAACAGTGGCTTGCTGTGTAT
GCAACCATAATTGGTGGTACTATAATGCTTGCTACAATTGGCTCAATGTGCTTTTGTGTGGTCCGGCATAGGTTGGAAGACTCAAAGATG
AGGAACATAAGGAGAGCCGAGACACTATCAGGTTCCTTTTCAGTGTCAATGGTATCAGATCCGGAGTTATATGGTGAAAAGTATAAAAGG
ATGTATGCAGXTGTAGGGACAGTCAGTTCCTGTGAGCGTGGGCATCTGGAGCAGAAAGATACCTTCAATGACTTCTGCACTAGTATCAAT
XATCCTGCAATATTAGCTGGATCATATTGTGTTGAGCTGCATTTGGCACTX
Edits in Original Sequence 
(5')XCTCAAGGACACGTTGATGTAGTCAATCTGCTTCTTGATATTGATCCTAACATCGCTAAGATAGCTCGAAACAATGGCAAGACTGT
GCTTCATACGGCTGCAAGAATGGGTCACTTGGAAGTTGTGAAATCACTTTTAAGCAAGGATCCCAGCATAGGATTCAGGACTGACAAGAA
AGGTCAAACTGCACTCCACATGGCTGTGAAGGGCCAAAACGTGGAGATTGTACAGGAATTAATAAAACCTGACTCCTCTGTTCTGAGCTT
GGGAGATAACAAAGGAAACACXGGCACTCCACATCGCAACAAGGAAGGGTCGAACTCAATGGTACAGAGTCTGATAGCAAGTGAAGGCAT
TGAGATCAATGCAACTAATAAGGCTGGAGAAACCCCCCTTGATATTTCGGAAAAGCTTGCAATGCCAGAATTAGATAGCATTTTAAAAGA
GGCAGGAGCTCTTCATTCTCAAGATCATGGAAAACCACCAAATGCTGCAAAGCAACTCAAACAGACTGTCAGTGACATAAAACATGACGT
GCAGTCCCAACTCCAACAATGCCGTCAGACTGGCTTTAGAGTAAGGAAGATTGCTAAGAAAGTGAAGAAGCTCCACATTAGTGGCCTTAA
CAATGCCATCAACTCTGCAACTGTTGTTGCTGTCCTGATTGCAACCGTTGCTTTTGCAGCCATCTTCACTGTGCCCGGCCAGTATGTCGA
GGAACAAACACCAGGATCTTCACTTGGGCAAGCCCATATAGCTAAAAATGCAGCTTTCTTAGTCTTCATTTTGTGCGATAGTCTGGCCTT
ATTTATCTCCCTTGCTGTTGTGGTGGTACAGACATCTATTGTTGXTGATAGAACAGAGGGCAAAGAAGCAACTTATGTTCGTGATAAACA
AGCTTATGTGGACGGCATGCCTCTTCATTTCAAtTGCCTTTATTTCTCTCACCTATGTGGTTGTTGGACGTCATGAACAGTGGCTTGCTG
TGTATGCAACCATAATTGGTGGTACTATAATGCTTGCTACAATTGGCTCAATGTGCTTTTGTGTGGTCCGGCATAGGTTGGAAGACTCAA
AGATGAGGAACATAAGGAGAGCCGAGACACTATCAGGTTCCTTTTCAGTGTCAATGGTATCAGATCCGGAGTTATATGGTGAAAAGTATA
AAAGGATGTATGCAGXTGTAGGGACAGTCAGTTCCTGTGAGCGTGGGCATCTGGAGCAGAAAGATACCTTCAATGACTTCTGCACTAGTA
TCAATXATCCTGCAATATTAGCTGGATCATATTGTGTTGAGCTGCATTTGGCACTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan