ESTScan Details for Unigene SGN-U299931

Score 
449
Direction 
Forward
Predicted Peptide Sequence 
FQPGPGRGQLAVDFAFASFLGALSIKRKKKKEDMALPKAKEIVSANPVVVFSKSTVRSAQREEAAGQVGANFKAVELDVESDGSEIQAAL
AELTGQKTVPNVFIGGKHIGGCDATTALHQNGKLVPLLTEAGAVASVSA
Predicted Coding Sequence 
XXGTTTCAACCGGGGCCAGGAAGAGGTCAGTTGGCXGTGGATTTTGCATTCGCTAGTTTTCTCGGGGCTCTGTCGATCAAGAGAAAGAAG
AAGAAAGAAGATATGGCTCTCCCAAAGGCTAAGGAGATCGTGTCGGCCAATCCTGTTGTCGTTTTCAGCAAGTCTACTGTCCGTTCTGCT
CAACGTGAAGAAGCTGCTGGTCAAGTTGGTGCCAACTTCAAGGCCGTCGAGCTGGATGTCGAAAGTGATGGAAGTGAGATTCAGGCAGCT
CTTGCTGAGTTGACTGGACAAAAGACTGTGCCCAATGTCTTTATTGGGGGCAAGCATATTGGTGGTTGTGATGCAACAACTGCACTGCAC
CAGAACGGCAAGCTTGTTCCTTTGCTAACTGAGGCCGGAGCTGTTGCTAGTGTGTCTGCTTAG
Edits in Original Sequence 
(5')XXGTTTCAACCGGGGCCAGGAAGAGGTCAGTTGGCXGTGGATTTTGCATTCGCTAGTTTTCTCGGGGCTCTGTCGATCAAGAGAAA
GAAGAAGAAAGAAGATATGGCTCTCCCAAAGGCTAAGGAGATCGTGTCGGCCAATCCTGTTGTCGTTTTCAGCAAGTCgTACTGTCCGTT
CTGCgTCAACGTGAAGAAGCTGCTgGGTCAAGTTGGTGCCAACTTCAAGGCCGTCGAGCTGGATGTCGAAAGTGATGGAAGTGAGATTCA
GGCAGCTCTTGCTGAGTTGACTGGACAAAAGACTGTGCCCAATGTCTTTATTGGGGGCAAGCATATTGGTGGTTGTGATGCAACAACTGC
ACTGCACCAGAACGGCAAGCTTGTTCCTTTGCTAACTGAGGCCGGAGCTGTTGCTAGTGTGTCTGCTTAG(3')AGGACCTTCAAGCATA
CGTTGGATGAATTATGGATGTTTCTGAAGCCATTATACATAAATAAAGCAATGTTTGTTAGTGTTTCGTTTCATTTTTCTGTTTGAGAAT
AAATTATGAATAGAAGCTTCGCTGGATTCCTGTACTAAAAAAAAAAAAAAAAAAAAGCCAACAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan