ESTScan Details for Unigene SGN-U299944

Score 
522
Direction 
Forward
Predicted Peptide Sequence 
MCPINASNLHRIFDKLDRDGDGFVGVDELMWLLETIGVQTSLDELELLVGKKGFLDSIDFLLFHDIVISGENMDEKKFRTKEQEEEDKHM
EKDLVQAFEVFDLNGDGFISSEELQSALCKLGLLDEQCGKDCKSMINVYDTNSDGKLDFEEFKNMMLHSDS
Predicted Coding Sequence 
ATGTGTCCCATTAACGCCTCTAATTTGCATCGGATTTTCGACAAGCTGGACAGAGATGGCGATGGCTTCGTCGGCGTTGACGAGCTAATG
TGGCTTCTGGAAACCATTGGTGTCCAAACTAGCTTGGATGAGCTCGAATTATTGGTCGGCAAAAAGGGTTTTCTGGACTCGATTGATTTC
TTGTTGTTTCATGATATTGTCATCAGTGGGGAGAATATGGATGAAAAGAAGTTCAGAACAAAGGAGCAAGAAGAAGAAGATAAGCACATG
GAGAAAGATCTTGTCCAAGCATTCGAGGTTTTCGATTTGAATGGAGATGGATTCATTTCCAGTGAGGAATTGCAGAGCGCATTATGCAAA
CTGGGATTGTTGGATGAACAGTGTGGGAAGGATTGCAAGAGTATGATTAACGTGTACGATACTAATTCTGATGGGAAGCTTGATTTCGAG
GAGTTTAAGAATATGATGTTGCATTCTGATTCTTAG
Edits in Original Sequence 
AAAATATCGAAGCATTTCACAGAAGTGAGCGATTCTTGATTTGCTTAAGAAAATTTCTTCATTTCCCTTTACAATCTGCAACAAA(5')A
TGTGTCCCATTAACGCCTCTAATTTGCATCGGATTTTCGACAAGCTGGACAGAGATGGCGATGGCTTCGTCGGCGTTGACGAGCTAATGT
GGCTTCTGGAAACCATTGGTGTCCAAACTAGCTTGGATGAGCTCGAATTATTGGTCGGCAAAAAGGGTTTTCTGGACTCGATTGATTTCT
TGTTGTTTCATGATATTGTCATCAGTGGGGAGAATATGGATGAAAAGAAGTTCAGAACAAAGGAGCAAGAAGAAGAAGATAAGCACATGG
AGAAAGATCTTGTCCAAGCATTCGAGGTTTTCGATTTGAATGGAGATGGATTCATTTCCAGTGAGGAATTGCAGAGCGCATTATGCAAAC
TGGGATTGTTGGATGAACAGTGTGGGAAGGATTGCAAGAGTATGATTAACGTGTACGATACTAATTCTGATGGGAAGCTTGATTTCGAGG
AGTTTAAGAATATGATGTTGCATTCTGATTCTTAG(3')ATAGCGTAGCAGACGAAAAAAGCAATCATTACTTTTTTTTTTTTCCTCTCT
TTAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan