ESTScan Details for Unigene SGN-U299968

Score 
1083
Direction 
Forward
Predicted Peptide Sequence 
PGQPAAVQLVVPSSFGGTTILSLNNNKYFSGTYGEDVIFIANDWHCALLPCYLKTMYQSRGIYMNAKVAFCIHNIAYQGRFPFADFSLLN
LPDQYKSSFDFIDGYDKPVKGRKINWMKAGILESNRVLTVSPYYALELVSGIEKGXGIGQYSPHEMVTGIVNGMDTHEWNPATDKYISAN
YDITTVMHAKALLKEALQAAVGLPVDRNIPLIGFIGRLEEQKGSDILVAAIPKLIHMNVQIVILGTGKRKFEKQIEQLEVMYPDKARGVA
KFNVPLAHMIIAGADFMLLPSRFEPCGLIQLHAMRYGTVPICASTGGLVDTVKDGYTGFHMGAFSVECDAVDPADILKIVVTVARALASY
GTLALKEMIRNCMSQELSWKGPAKKWETVLVSLGVAGSEAGVDGDEIAPLAKENVATP
Predicted Coding Sequence 
CCAGGACAACCAGCTGCGGTTCAGCTTGTTGTGCCAAGCAGCTTTGGAGGCACCACAATTTTGAGTTTAAACAACAACAAATACTTCTCT
GGAACATATGGAGAGGATGTTATCTTCATTGCCAATGATTGGCATTGTGCTCTTCTACCATGCTACCTGAAGACTATGTACCAGTCTAGA
GGAATCTACATGAACGCTAAAGTTGCTTTCTGCATTCACAACATTGCCTACCAGGGAAGATTTCCTTTTGCAGACTTCTCTCTTCTCAAT
CTCCCTGATCAATATAAGAGTTCCTTTGACTTCATTGATGGATATGACAAACCAGTGAAAGGAAGGAAAATTAACTGGATGAAGGCTGGA
ATTTTGGAGTCAAACAGGGTCTTAACTGTGAGCCCGTACTATGCCCTGGAGCTTGTTTCTGGCATTGAAAAGGGTGXTGGAATTGGACAA
TATTCTCCGCATGAAATGGTAACAGGAATTGTGAATGGAATGGATACCCACGAGTGGAATCCGGCGACTGATAAATATATTTCTGCCAAT
TATGACATTACAACTGTTATGCATGCAAAGGCCCTACTAAAAGAAGCTCTCCAAGCTGCTGTTGGATTACCAGTTGACAGGAATATTCCG
CTGATTGGCTTCATTGGCAGGCTCGAAGAGCAGAAAGGATCAGACATCCTTGTTGCCGCCATTCCCAAGCTCATTCACATGAATGTTCAG
ATAGTAATCCTTGGGACTGGCAAAAGGAAATTTGAGAAGCAGATTGAACAGCTTGAGGTGATGTACCCCGACAAAGCAAGAGGAGTGGCA
AAATTCAATGTCCCATTAGCCCACATGATTATTGCTGGAGCTGACTTTATGCTGCTTCCAAGTAGATTTGAACCTTGTGGTCTAATTCAA
CTGCACGCCATGCGCTATGGAACAGTGCCTATATGTGCTTCGACTGGTGGACTTGTTGACACAGTCAAAGATGGCTACACGGGGTTCCAT
ATGGGAGCCTTCAGCGTTGAATGCGATGCGGTTGATCCAGCTGACATCCTCAAGATCGTAGTGACTGTAGCCAGAGCTCTCGCTAGCTAT
GGAACCCTTGCCCTAAAAGAGATGATTAGAAATTGCATGTCACAGGAGCTCTCCTGGAAGGGGCCTGCTAAGAAGTGGGAAACAGTGTTG
GTGAGCTTAGGTGTTGCTGGGAGTGAAGCTGGCGTTGACGGAGACGAAATTGCCCCACTCGCCAAGGAAAACGTTGCCACACCTTGA
Edits in Original Sequence 
(5')CCAGGACAACCAGCTGCGGTTCAGCTTGTTGTGCCAAGCAGCTTTGGAGGCACCACgAATTTTGAGTTTAAACAACAACAAATACT
TCTCTGGAACATATGGAGAGGATGTTATCTTCATTGCCAATGATTGGCATTGTGCTCTTCTACCATGCTACCTGAAGACTATGTACCAGT
CTAGAGGAATCTACATGAACGCTAAAGTTGCTTTCTGCATTCACAACATTGCCTACCAGGGAAGATTTCCTTTTGCAGACTTCTCTCTTC
TCAATCTCCCTGATCAATATAAGAGTTCCTTTGACTTCATTGATGGATATGACAAACCAGTGAAAGGAAGGAAAATTAACTGGATGAAGG
CTGGAATTTTGGAGTCAAACAGGGTCTTAACTGTGAGCCCGTACTATGCCCTGGAGCTTGTTTCTGGCATTGAAAAGGGTGXTGGAATTG
GACAATATTCTCCGCATGAAATGcGTAACAGGAATTGTGAATGGAATGGATACCCACGAGTGGAATCCGGCGACTGATAAATATATTTCT
GCCAATTATGACATTACAACTGTTATGCATGCAAAGGCCCTACTAAAAGAAGCTCTCCAAGCTGCTGTTGGATTACCAGTTGACAGGAAT
ATTCCGCTGATTGGCTTCATTGGCAGGCTCGAAGAGCAGAAAGGATCAGACATCCTTGTTGCCGCCATTCCCAAGCTCATTCACATGAAT
GTTCAGATAGTAATCCTTGGGACTGGCAAAAGGAAATTTGAGAAGCAGATTGAACAGCTTGAGGTGATGTACCCCGACAAAGCAAGAGGA
GTGGCAAAATTCAATGTCCCATTAGCCCACATGATTATTGCTGGAGCTGACTTTATGCTGCTTCCAAGTAGATTTGAACCTTGTGGTCTA
ATTCAACTGCACGCCATGCGCTATGGAACAGTGCCTATATGTGCTTCGACTGGTGGACTTGTTGACACAGTCAAAGATGGCTACACGGGG
TTCCATATGGGAGCCTTCAGCGTTGAATGCGATGCGGTTGATCCAGCTGACATCCTCAAGATCGTAGTGACTGTAGCCAGAGCTCTCGCT
AGCTATGGAACCCTTGCCCTAAAAGAGATGATTAGAAATTGCATGTCACAGGAGCTCTCCTGGAAGGGGCCTGCTAAGAAGTGGGAAACA
GTGTTGGTGAGCTTAGGTGTTGCTGGGAGTGAAGCTGGCGTTGACGGAGACGAAATTGCCCCACTCGCCAAGGAAAACGTTGCCACACCT
TGA(3')GTGTCTCATCCATCATCCAGCTTAGCTATATATAGTTAGCCTATTGCCTCTCACCTTTTAACCCTTTTTAATAAAAGCGAAGT
AACGGATCAGATTATGCTTTTGTTGAGCTGTTGCTGGAAAGGTGGATTTGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan