ESTScan Details for Unigene SGN-U299992

Score 
794
Direction 
Forward
Predicted Peptide Sequence 
MVKAVAVLSGNECVSGTIFLTQEGDGPTTVTGTITGLKPGLHGFHVHALGDTTNGCMSTGPHFNPKGKEHGAPCDENRHAGDLGNVTADQ
DGTANVLVVDNQIPLTGPHSVVGRAVVVHADPDDLGRGGHELSKTTGNAGGRVACGVIGXARLRLTVACDQSSXNKNEILFLVAVECILR
LCSSYHYVRVITLFCPIFPMWSETAGIGTAPTXVAGLHALKMAARIITSTSDVKNAH
Predicted Coding Sequence 
ATGGTGAAGGCTGTTGCAGTTCTTAGTGGCAATGAGTGTGTGAGTGGCACCATCTTTTTGACCCAAGAAGGAGATGGCCCTACAACTGTT
ACTGGAACAATCACCGGTCTGAAACCAGGGCTCCATGGCTTTCATGTCCATGCCCTTGGAGACACAACGAATGGCTGCATGTCAACTGGA
CCACATTTCAATCCAAAAGGCAAAGAGCATGGTGCTCCTTGCGATGAGAACCGTCATGCTGGTGATCTTGGAAATGTTACTGCTGATCAA
GATGGTACTGCCAATGTGTTAGTTGTTGACAATCAGATTCCACTCACTGGACCACATTCTGTTGTTGGAAGGGCAGTCGTTGTCCATGCA
GATCCAGATGATCTTGGGAGAGGAGGACATGAACTCAGCAAAACCACTGGCAATGCTGGTGGTAGGGTTGCCTGTGGTGTCATTGGTXCT
GCAAGGCTAAGATTGACTGTTGCTTGTGATCAATCTTCCGAXAATAAAAATGAGATTCTGTTTCTTGTAGCAGTTGAATGTATTCTCAGA
CTATGTTCTTCTTACCATTATGTTCGAGTCATAACACTTTTTTGTCCCATTTTCCCAATGTGGAGTGAAACTGCTGGTATTGGGACTGCC
CCTACTAXAGTTGCAGGTTTACATGCACTGAAAATGGCAGCTAGAATAATCACAAGTACAAGTGATGTGAAAAATGCCCAT
Edits in Original Sequence 
CTGAATCCTGACAAGTGACCCCCTTTACTTGTATATACTTGTGGCTGTAGTGGTTGTAGTTCATGTCCTAGCTCACCACTTTGTTCTTTC
TCTGCATTCTTTTCTCTTATTCTACAACATTCATCTATCATCTCCCTCCCTCTCTCTTTCCCTTGGGGTGCTCTGAGATCACGGAAGACA
(5')ATGGTGAAGGCTGTTGCAGTTCTTAGTGGCAATGAGTGTGTGAGTGGCACCATCTTTTTGACCCAAGAAGGAGATGGCCCTACAAC
TGTTACTGGAACAATCACCGGTCTGAAACCAGGGCTCCATGGCTTTCATGTCCATGCCCTTGGAGACACAACGAATGGCTGCATGTCAAC
TGGACCACATTTCAATCCAAAAGGCAAAGAGCATGGTGCTCCTTGCGATGAGAACCGTCATGCTGGTGATCTTGGAAATGTTACTGCTGA
TCAAGATGGTACTGCCAATGTGTTAGTTGTTGACAATCAGATTCCACTCACTGGACCACATTCTGTTGTTGGAAGGGCAGTCGTTGTCCA
TGCAGATCCAGATGATCTTGGGAGAGGAGGACATGAACTCAGCAAAACCACTGGCAATGCTGGTGGTAGGGTTGCCTGTGGTGTCATTGG
TXCTGCAAGGCTAAGATTGACTGTTGCTTGTGATCAATCTTCCGAXAATAAAAATGAGATTCTGTTTCTTGTAGCAGTTGAATGTATTCT
CAGACTATGTTCTTCTTACCATTATGTTCGAGTCATAACACTTTTTTGTCCCATTTTCCCAATGTaGGAGTGAAACTGCTGGTATTGGGA
CTGCCCCTACTAXAGTTGCAGGTTTACATGCACTGAAAATGGCAGCTAGAATAATCACAAGTACAAGTGATGTGAAAAATGCCCAT(3')
TTTCCTTTTTTTTTTTTTAATGAAAAATCAGGGCAAGTTTGATCTTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan