ESTScan Details for Unigene SGN-U300054

Score 
85
Direction 
Forward
Predicted Peptide Sequence 
AKVQAPREHKLTTLLLIKSPQFSNQQKQESMNAEVISSGHLQLFPTSSNQDIVAPSFHLAAGPVPEHSIKAKKKTWAAQKTARAAVYAPT
QTQAETFYDMLGISETGSISDIKKAYKQLARKYHPDVSPADRTEEYTKRFIEVQEAYETLSDPQTRALYDMNLGRGLHFAFSTGRRNERM
DDVEEWKLRWQSQLDELRLWSMHRDNVSSAVRGKAAASPSSSWGSRMRRKRTDIYDLGFXVAYILPIASYKLGPFIVGILSDIIMTDFAA
AAGSTGSCIQMYIINFFSLLFGRVYNSAISFWLLELLGKINISL
Predicted Coding Sequence 
XXTGCAAAAGTGCAAGCTCCAAGAGAACACAAATTAACTACACTACTACTGATTAAAAGCCCGCAATTCAGCAACCAACAAAAGCAAGAA
AGCATGAACGCCGAGGTTATTTCCAGCGGTCACCTGCAACTTTTCCCAACAAGTTCAAATCAAGACATTGTGGCTCCCAGCTTCCATTTA
GCGGCAGGGCCAGTACCGGAGCATAGCATTAAAGCCAAGAAGAAGACCTGGGCCGCTCAGAAAACTGCCAGGGCCGCCGTTTATGCACCG
ACCCAGACCCAGGCCGAAACTTTCTATGATATGCTGGGAATTTCGGAAACAGGGTCGATTTCCGATATCAAGAAAGCCTACAAACAGTTA
GCAAGAAAATACCACCCTGACGTGTCACCGGCGGACCGCACGGAAGAGTACACCAAGAGGTTTATCGAGGTTCAGGAAGCTTACGAGACG
CTTTCTGATCCACAGACTAGAGCTTTGTACGATATGAATTTAGGTCGAGGATTGCATTTCGCTTTTTCAACCGGAAGACGCAACGAGAGA
ATGGATGATGTGGAGGAATGGAAACTTAGGTGGCAATCTCAACTGGATGAGCTGAGGCTGTGGAGCATGCACAGGGATAATGTCTCCTCC
GCCGTTAGAGGGAAGGCAGCGGCGTCGCCCTCGTCGTCCTGGGGTAGTCGAATGCGCCGAAAGAGAACTGACATTTATGATCTTGGATTT
AXGGTAGCATATATTTTGCCTATTGCTAGCTATAAGCTAGGTCCGTTCATCGTGGGGATTCTCTCTGACATAATCATGACAGATTTCGCC
GCCGCCGCCGGCAGCACTGGGAGCTGTATCCAGATGTATATAATTAATTTTTTCTCTCTTCTATTTGGACGTGTTTATAACTCGGCCATA
TCGTTTTGGCTTCTAGAATTATTGGGAAAAATAAATATTTCCCTX
Edits in Original Sequence 
(5')XXTGCAAAAGTGCAAGCTCCAAGAGAACACAAATTAACTACACTACTACTGATTAAAAGCCCGCAATTCAGCAACCAACAAAAGCA
AGAAAGCATGAACGCCGAGGTTATTTCCAGCGGTCACCTGCAACTTTTCCCAACAAGTTCAAATaCAAGACATTGTGGCTCCCAGCTTCC
ATTTAGCGGCAGGGCCAGTACCGGtAGCATAGCATTAAAGCCAAGAAGAAGACCTGGGCCGCTCAGAAtAACTGCCAGGGCCGCCGTTTA
TGCACCGACCCAGACCCAGGCCGAAACTTTCTATGATATGCTGGGAATTTCGGAAACAGGGTCGATTTCCGATATCAAGAAAGCCTACAA
ACAGTTAGCAAGAAAATACCACCCTGACGTGTCACCGGCGGACCGCACGGAAGAGTACACCAAGAGGTTTATCGAGGTTCAGGAAGCTTA
CGAGACGCTTTCTGATCCACAGACTAGAGCTTTGTACGATATGAATTTAGGTCGAGGATTGCATTTCGCTTTTTCAACCGGAAGACGCAA
CGAGAGAATGGATGATGTGGAGGAATGGAAACTTAGGTGGCAATCTCAACTGGATGAGCTGAGGCTGTGGAGCATGCACAGGGATAATGT
CTCCTCCGCCGTTAGAGGGAAGGCAGCGGCGTCGCCCTCGTCGTCCTGGGGTAGTCGAATGCGCCGAAAGAGAACTGACATTTATGATCT
TGGATTTAXGGTAGCATATATTTTGCCTATTGCTAGCTATAAGCTAGGTCCGTTCATCGTGGGGATTCTCTCTGACATAATCATGACAGA
TTTCGCCGCCGCCGCCGGCAGCACTGGGAGCTGTATCCAGATGTATATAATTAATTTTTTCTCTCTTCTATTTGGACGTGTTTATAACTC
GGCCATATCGTTTTGGCTTCTAGAATTATTGGGAAAAATAAATATTTCCCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan