Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U300088

Score 
373
Direction 
Forward
Predicted Peptide Sequence 
EDVSAGLVLRRVGVAGFVAEGSQDLVSGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVD
AVVYLVDAYDKERFAESKKELDALLSDEALANVPFLILGNKIDIPYAASEDELRYHLGLTGVTTGKGKVNLGDSXRPSFRGVYVQYRAKM
GYGDGLQMGLSIYKVANRQQYDSYSLTLLAEGKQTQFYLFTVPIIMSLVGLDLYGLYFQFASIGELAILDAV
Predicted Coding Sequence 
GAAGATGTTTCTGCTGGATTGGTTCTACGGCGTGTTGGCGTCGCTGGGTTTGTGGCAGAAGGAAGCCAAGATCTTGTTTCTGGCCTCGAT
AACGCAGGCAAAACCACTCTTCTTCACATGCTCAAAGACGAGAGGCTTGTGCAGCATCAACCGACGCAGTATCCTACGTCGGAGGAGCTC
AGTATTGGCAAAATCAAGTTTAAAGCCTTTGATTTGGGAGGCCATCAGATCGCTCGCCGTGTCTGGAAGGATTACTATGCTAAGGTTGAT
GCAGTGGTATACTTGGTGGATGCTTATGACAAAGAACGCTTTGCTGAATCAAAGAAGGAATTAGATGCACTCCTGTCTGATGAAGCCCTT
GCTAATGTCCCTTTCCTCATTCTGGGTAACAAGATTGACATACCATATGCTGCCTCAGAGGATGAGTTGCGTTACCACCTTGGGCTAACT
GGTGTCACCACTGGCAAAGGGAAGGTAAATCTTGGAGATTCTAAXCGTCCGTCCTTTAGAGGTGTTTATGTGCAGTATCGTGCTAAGATG
GGATATGGTGATGGXCTTCAAATGGGTCTCTCAATATATAAAGTGGCTAATCGTCAGCAATATGATAGTTACAGTCTTACTCTCCTTGCT
GAGGGGAAGCAGACTCAATTTTATCTGTTCACTGTCCCAATTATTATGTCTCTAGTTGGCTTAGATTTGTATGGTTTGTACTTTCAGTTT
GCGTCAATTGGAGAATTAGCAATTCTTGATGCAGTGTAA
Edits in Original Sequence 
CTGCCTCCCTCCCTCCCTCGCTGCCTGCCTCAAAGCGCATCTCATTTCTCTTGTTCTCTCCAGGGGAGTCGGTACAGTCGGTAAAGAGTA
AAAGGGGCAGAGAGAGAGAGAGAGAGAGTAAAAATACTAGTAGTGCTAGAGGAGAGGAGCAGTTAAACAGATCTCTCCCTCCTTTCTCTT
CTAATTTAGAAAGAAGAAGAAGAGAAAACAAACAAACCAAAAAAAAGAAGG
(5')GAAGATGTTTCTGCTGGATTGGTTCTACGGCGTGT
TGGCGTCGCTGGGTTTGTGGCAGAAGGAAGCCAAGATCTTGTTTCTaGGCCTCGATAACGCAGGCAAAACCACTCTTCTTCACATGCTCA
AAGACGAGAGGCTTGTGCAGCATCAACCGACGCAGTATCCTACGTCGGAGGAGCTCAGTATTGGCAAAATCAAGTTTAAAGCCTTTGATT
TGGGAGGCCATCAGATCGCTCGCCGTGTCTGGAAGGATTACTATGCTAAGGTTGATGCAGTGGTATACTTGGTGGATGCTTATGACAAAG
AACGCTTTGCTGAATCAAAGAAGGAATTAGATGCACTCCTGTCTGATGAAGCCCTTGCTAATGTCCCTTTCCTCATTCTGGGTAACAAGA
TTGACATACCATATGCTGCCTCAGAGGATGAGTTGCGTTACCACCTTGGGCTAACTGGTGTCACCACTGGCAAAGGGAAGGTAAATCTTG
GAGATTCTAAXCGTCCGTCCTTTAGAGGTGTTTATGTGCAGTATCGTGCgTAAGATGGGATATGGTGATGGXCTTCAAATGGGTCTCTCA
ATATATAAAGTaGGCTAATCGTCAGCAATATGATAGTTACAGTCTTACTCTCCTTGCTGAGGGGAAGCAGACTCAATTTTATCTGTTCAC
TGTCCCAAtTTATTATGTCTCTAGTTGGCTTAGATTTGTATGGTTTGTACTTTCAGTTTGCGTCAATTGGAGAATTAcGCAATTCTTGAT
GCAGTGTAA(3')AATTTACTTGTAGCCAGGACTGCCCAGCGTTTAGATTTGTCACTAAAACATTTTTCCCCAGCTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan