ESTScan Details for Unigene SGN-U300108

Score 
919
Direction 
Forward
Predicted Peptide Sequence 
LISIHLFLCFFVSGSKNNLGLAEWELRVIFIQENGDXKSELWLKNFHGNFLTHFSRPYLLSMEVPGEDEVKKAEDRMTSAAAFVEGGIQE
ACDDSAAYALKPSAESDPSTVTFASMSFTFNVSLNGVKEVRIXPMCWQTISLKDPASQQLLDAVEREKRIRFTPARNATIFHHPTLGDFE
LQHLPVGVNDSELEERIIQHLAAAAAMGRARHIARREGSRGHSSAQGRPHFLVFSTHASAPGPGAGPASASVGAEPEADATAPVNDPSSL
TEQSAVNHCNAPPNLTSVPSGQLSASSSGSVAMLNNPRDLSTDNRSVARQAPSGQDRAGTSDFQSFSDSWRSRFSAMSMKYKESLSKSTR
GWKERLFARSNSMADIRSEVRREVNAGIASVSRMMERLETRENSRPGPVSTSNNPPVTEQNNPGNLDESPLSDISALPANSXLALSGIHC
LAVASFLSIAALEVIKTRPPNXEMLIEDAYMGRAECWREPLLIDDAXLGKEKPEAEQRFLR
Predicted Coding Sequence 
CTAATCTCTATCCATCTCTTTCTTTGTTTCTTTGTCTCTGGGTCCAAGAATAATTTGGGCTTAGCTGAATGGGAACTTAGAGTTATCTTC
ATCCAGGAAAATGGGGATAAXAAATCAGAGCTTTGGCTTAAAAATTTCCATGGAAATTTCTTGACCCATTTTTCTAGGCCATATCTTCTT
TCAATGGAGGTTCCGGGGGAGGATGAGGTTAAAAAGGCAGAGGATCGTATGACATCAGCCGCGGCTTTTGTTGAAGGAGGTATACAGGAG
GCATGTGATGATTCTGCAGCATATGCCTTGAAGCCTTCTGCXGAAAGTGATCCATCCACGGTAACATTTGCAAGCATGAGTTTCACCTTC
AATGTATCCTTGAATGGTGTCAAAGAAGTTCGAATTGXTCCAATGTGCTGGCAAACTATAAGTTTGAAAGATCCTGCTAGTCAACAATTG
CTTGATGCTGTAGAAAGAGAGAAACGTATTAGGTTCACTCCAGCAAGAAATGCCACGATATTTCATCATCCCACTCTGGGGGATTTTGAA
CTGCAACACTTGCCTGTTGGAGTTAATGATTCTGAACTGGAAGAACGCATTATTCAGCACTTGGCTGCTGCTGCTGCAATGGGAAGGGCA
CGTCATATTGCTCGTAGAGAGGGCTCAAGGGGTCACTCATCTGCTCAGGGTCGTCCACATTTTCTGGTGTTTTCCACACATGCCAGTGCC
CCAGGTCCAGGCGCTGGTCCTGCTTCAGCTTCTGTAGGAGCGGAACCTGAGGCAGATGCAACAGCCCCTGTTAATGATCCTTCTTCACTC
ACCGAGCAATCAGCAGTGAATCATTGCAATGCACCXCCAAATCTTACTAGTGTTCCTAGTGGTCAACTCTCTGCTTCGTCATCTGGATCA
GTTGCCATGCTTAACAACCCTCGAGATCTCTCCACTGACAATAGAAGCGTGGCTCGTCAGGCACCATCAGGTCAAGATAGAGCAGGAACA
TCAGATTTCCAGTCTTTTTCAGATTCCTGGAGATCTCGTTTTAGTGCAATGTCAATGAAATACAAAGAATCTCTTTCAAAGAGCACAAGA
GGATGGAAAGAAAGGCTTTTTGCACGAAGTAATTCCATGGCAGATATTCGCTCAGAAGTTAGGAGAGAAGTGAATGCTGGAATTGCTAGT
GTTTCCCGCATGATGGAACGCCTAGAAACAAGAGAAAACAGTAGACCTGGTCCTGTTTCAACGTCAAATAATCCTCCAGTGACTGAGCAA
AATAACCCTGGGAATTTGGATGAATCACCGTTGAGTGACATTTCGGCTCTTCCTGCAAATTCTGXTCTCGCGTTAAGTGGTATACATTGT
TTAGCTGTTGCATCTTTCCTCAGCATTGCAGCTTTGGAGGTTATTAAAACTCGTCCTCCAAATGXTGAAATGCTGATAGAGGATGCTTAT
ATGGGCAGGGCAGAATGTTGGAGAGAACCATTACTGATAGATGATGCCAAXTTAGGGAAAGAGAAGCCTGAGGCGGAGCAGCGATTTCTG
CGTTAA
Edits in Original Sequence 
(5')CTAATCTCTATCCATCTCTTTCTTTGTTTCTTTGTCTCTGGGTCCAAGAATAATTTGGGCTTAGCTGAATGGGAACTTAGAGTTAT
CTTCATCCAGGAAAATaGGGGATAAXAAATCAGAGCTTTGGCTTAAAAATTTCCATGGAAATTTCTTGACCCATTTTTCTAGGCCATATC
TTCTTTCAATGGAGGTTCCGGGGGAGGATGAGGTTAAAAAGGCAGAGGATCGTATGACATCAGCCGCGGCTTTTGTTGAAGGAGGTATAC
AGGAGGCATGTGATGATTCaTGCAGCATATGCCTTGAAGCCTTCTGCXGAAAGTGATCCATCCACGGTAACtATTTGCAAGCATGAGTTT
CACCTTCAATGTATCCTTGAATGGTGTCAAAGAAGTTCGAATTGXTCCAATGTGCTGGCAAACTATAAGTTTGAAAGATCCTGCTAGTCA
ACAATTGCTTGATGCTGTAGAAAGAGAGAAACGTATTAGGTTCACTCCAGCAAGAAATGCCACGATATTTCATCATCCCACTCTGGGGGA
TTTTGAACTGCAACACTTGCCTGTTGGAGTTAATGATTCTGAACTGGAAGAACGCATTATTCAGCACTTGGCTGCTGCTGCTGCAATGGG
AAGGGCACGTCATATTGCTCGTAGAGAGGGCTCAAGGGGTCACTCATCTGCTCAGGGTCGTCCACATTTTCTGGTGTTTTCCACACATGC
CAGTGCCCCAGGTCCAGGCGCTGGTCCTGCTTCAGCTTCTGTAGGAGCGGAACCTGAGGCAGATGCAACAGCCCCTGTTAATGATCCTTC
TgTCACTCACCGAGCAATCAGCAGTGAATCATTGCAATGCACCXCCAAATCTTACTAGTGTTCCTAGTGGTCAACTCTCTGCTTCGTCAT
CTGGATCAGTTGCCATGCTTAACAACCCTCGAGATCTCTCCACTGACAATAGAAGCGTGGCTCGTCAGGCACCATCAGGTCAAGATAGAG
CAGGAACATCAGATTTCCAGTCTTTTTCAGATTCCTGGAGATCTCGTTTTAGTGCAATGTCAATGAAATACAAAGAATCTCTTTCAAAGA
GCACAAGAGGATGGAAAGAAAGGCTTTTTGCACGAAGTAATTCCATGGCAGATATTCGCTCAGAAGTTAGGAGAGAAGTGAATGCTGGAA
TTGCTAGTGTTTCCCGCATGATGGAACGCCTAGAAACAAGAGAAAACAGTAGACCTGGTCCTGTTTCAACGTCAAATAATCCTCCAGTGA
CTGAGCAAAATAACCCTGGGAATTTGGATGAATCACCGTTGAGTGACATTTCGGCTCTTCCTGCAAATTCTGXTCTCGCGTTAAGTGGTA
TACATTGTTTaAGCTGTTGCATCTTTCCTCAGCATTGCAGCTTTGGAGGTTATTAAAACTCGTCCTCCAAATGXTGAAATGCTGATAGAG
GATGCTTATATGGGCAGGGCAGAATGTTGGAGAGAACCATTACTGATAGATGATGCCAAXTTAGGGAAAGAGAgAGCCTGAGGCGGAGCA
GCGATTTCTGCGTTAA(3')AACGCTGTAAATTTGTTTATGCAAACTTGGGTTTGTTATGTATTGCACTCCAATGCTTGTAATAGCTGTT
GGACTGAAGTGGCAGTCTTCTATACCCTTCTGCTTGAGAACTAATTTTTCTCTAATTCTAAGGCTGAAGGCTAATGAGCCCCAGCAAAAA
AAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan